Recombinant Edwardsiella ictaluri Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
arnC; NT01EI_1414; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-325
Protein Length
full length protein
Species
Edwardsiella ictaluri (strain 93-146)
Target Names
arnC
Target Protein Sequence
MSDFKTIQFVSVVIPVYNEQDSLSELLKRTIAACDSMGKQYEIVLVDDGSSDRSAEILRE AAQRPGSRVVAVLLNRNYGQHSAIMAGFNHIKGDLVITLDADLQNPPEEIPRLVEAADQG YDVVGTIRQDRQDSWFRRRASRLINGLIQRTTGKSMSDYGCMLRAYRSSVIKAMLHCHER STFIPILANSFARRTIEIPVKHAEREHGESKYGLMKLINLMYDLVTCLTTTPLRALSIFG SVVALLGFAFAVLLILMRLTLGPQWAAEGVFTLFAVLFIFIGAQFVGMGLLGEYIGRIYN DVRARPRYFIQNVVRANQPDEEQEK
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This modified arabinose is incorporated into lipid A, contributing to resistance against polymyxins and cationic antimicrobial peptides.

Database Links
Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of arnC in Edwardsiella ictaluri?

ArnC functions as an integral membrane glycosyltransferase that catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose to undecaprenyl phosphate in the bacterial inner membrane . In Gram-negative bacteria like E. ictaluri, this enzymatic activity is part of a larger pathway that ultimately leads to the modification of Lipid A with aminoarabinose (L-Ara4N), conferring resistance against polymyxin antibiotics and various cationic antimicrobial peptides (CAMPs) . The modification alters the net charge of the bacterial outer membrane, reducing the binding affinity of positively charged antimicrobial molecules.

How does arnC expression relate to antimicrobial resistance in E. ictaluri?

Expression of arnC is frequently upregulated in response to environmental stress conditions that trigger antimicrobial resistance mechanisms. Research indicates that the enzymatic modification facilitated by ArnC represents one of several intrinsic resistance strategies employed by E. ictaluri against CAMPs . This modification works in concert with other enzymes like Ugd, which has been shown to have pleiotropic effects in E. ictaluri, influencing not only LPS synthesis but also bacterial motility . Researchers studying resistance mechanisms should consider analyzing multiple gene expression patterns, including arnC, phoP, arnT, and neuC, particularly under conditions with and without antimicrobial exposure.

What is the relationship between arnC and vaccine development for aquaculture?

The recombinant expression of arnC in attenuated E. ictaluri strains represents a strategic approach in developing live recombinant vaccines for the aquaculture industry. As the largest aquaculture industry in the United States is channel catfish (Ictalurus punctatus) production, researchers are actively pursuing bath/oral live recombinant attenuated Edwardsiella vaccines (RAEVs) that can provide protection against both E. ictaluri and other pathogens like Flavobacterium columnare . Understanding arnC function contributes to optimizing these vaccine vectors through balanced attenuation and controlled immune protection.

How can structural analysis of ArnC inform drug design targeting polymyxin resistance?

Recent cryo-electron microscopy structures of ArnC from Salmonella enterica in both apo and nucleotide-bound conformations reveal critical insights into its catalytic mechanism . These structures demonstrate that ArnC undergoes a conformational transition upon binding to its partial donor substrate. Using this structural information, researchers can design inhibitors that target specific binding sites or conformational states of the enzyme.

When approaching structure-based drug design against ArnC, researchers should:

  • Focus on the nucleotide-binding domain revealed in recent structures

  • Consider transition state analogs that could prevent the conformational changes required for catalysis

  • Develop compounds that interfere with substrate coordination

  • Target the metal-dependent catalytic mechanism common to related polyprenyl phosphate glycosyltransferases

Molecular modeling based on these structures, including both coarse-grained and atomistic simulations, can provide further insights into substrate coordination before and during catalysis, informing rational drug design efforts .

What genetic engineering approaches are most effective for studying arnC function in E. ictaluri?

To effectively study arnC function in E. ictaluri, researchers should employ multiple complementary genetic approaches:

  • Allelic exchange methodology: Using a suicide vector system with appropriate selection markers (such as Col and Amp resistance) combined with counter-selection (e.g., sacB-based sucrose sensitivity) enables precise genetic modifications . This approach allows for the generation of clean gene deletions without introducing additional antibiotic resistance genes.

  • Regulated gene expression systems: For functional studies, implementing arabinose-inducible expression systems (araC PBAD) similar to those used for other E. ictaluri virulence genes allows for controlled expression levels .

  • RT-PCR analysis: Semi-quantitative RT-PCR with appropriate normalization (such as using 16S rRNA genes as controls) provides valuable information on expression patterns under various conditions, particularly in response to antimicrobial exposure .

  • Complementation studies: Reintroducing wild-type or modified arnC genes into deletion mutants confirms phenotypes and allows structure-function analyses.

When designing these experiments, researchers should consider the pleiotropic effects of related genes and potential polar effects of mutations on adjacent genes in the same operon.

How can recombinant E. ictaluri expressing modified arnC be optimized for balanced attenuation and immune protection?

Developing optimized recombinant E. ictaluri expressing modified arnC requires careful balancing of attenuation and immunogenicity. Successful approaches include:

  • Regulated delayed attenuation: Engineering strains with the ΔPcrp11::TT araC PBAD crp, ΔPinsA31::TT araC PBAD insA, and ΔPfur70::TT araC PBAD fur deletion-insertion mutations allows bacteria to exhibit near wild-type attributes initially for efficient colonization but become attenuated after several divisions in vivo .

  • Delayed antigen synthesis: Programming the vaccine strain to gradually eliminate virulence in vivo while simultaneously increasing synthesis of heterologous protective antigens before final lysis.

  • Controlled lysis systems: Implementing regulated delayed lysis for biocontainment ensures the vaccine strain is programmed to self-lyse after 5-10 cell divisions, minimizing environmental impact .

  • Balanced-lethal systems: Developing a balanced-lethal plasmid vector-bacterial host system helps maintain stable expression of recombinant antigens without antibiotic selection pressure .

When evaluating these approaches, researchers should assess:

  • Colonization efficiency in lymphoid tissues

  • Immune protection against different strains of target pathogens

  • In vivo lysis kinetics for biocontainment

  • Stability of attenuation in environmental conditions

What are the optimal conditions for expressing recombinant arnC in E. ictaluri?

Expressing recombinant arnC in E. ictaluri requires careful optimization of multiple parameters:

ParameterRecommended ConditionConsiderations
Growth mediaBHI (Brain Heart Infusion)Supports robust growth of E. ictaluri
Temperature28°CE. ictaluri optimal growth temperature
Induction systemaraC PBADAllows titratable expression
Arabinose concentration0.2% for full inductionAdjust based on expression requirements
Growth phaseLate exponential (OD600 ~0.85)Optimal for protein expression
SelectionCol/Amp initially, then counterselectionFor stable integration without markers

When optimizing expression, researchers should monitor both mRNA levels via semi-quantitative RT-PCR and protein expression through appropriate detection methods. The expression system should be validated by functional assays measuring enzyme activity or resistance phenotypes.

How should researchers design experiments to evaluate cross-protective immunity from recombinant E. ictaluri vaccines expressing arnC?

Designing robust experiments to evaluate cross-protective immunity requires a multi-faceted approach:

  • Challenge studies: Test vaccinated fish against multiple isolates of both E. ictaluri and F. columnare to assess cross-protection breadth.

  • Delivery method comparison: Evaluate both bath immersion and oral delivery routes, with particular attention to administering the vaccine to different age groups (from egg to adult stages) .

  • Immunological assessments:

    • Measure antibody responses via ELISA

    • Assess cell-mediated immunity through lymphocyte proliferation assays

    • Evaluate cytokine profiles in vaccinated fish

  • Booster immunization optimization: Test various intervals and dosages for booster immunization through food to establish optimal protection protocols .

  • Long-term protection: Monitor vaccinated fish over extended periods (minimum 6 months) to determine duration of immunity.

  • Field trials: After laboratory validation, conduct controlled field trials in production environments to confirm efficacy under real-world conditions.

Data collection should include relative percent survival (RPS), specific growth rate (SGR), and feed conversion ratio (FCR) to assess both protection and production impacts.

What analytical methods are most appropriate for characterizing the enzymatic activity of ArnC?

Characterizing ArnC enzymatic activity requires specialized techniques given its integral membrane nature and unique substrates:

  • In vitro reconstitution assays: Using purified enzyme in proteoliposomes with synthesized substrates (undecaprenyl phosphate and UDP-4-deoxy-4-formamido-L-arabinose).

  • Radioisotope incorporation: Tracking transfer of radiolabeled formamido-arabinose to lipid substrates.

  • Mass spectrometry: LC-MS/MS analysis of reaction products to confirm specific enzymatic modifications.

  • Kinetic analysis: Determining enzyme parameters (Km, Vmax, kcat) using varying substrate concentrations under different conditions.

  • Metal dependence studies: Assessing enzymatic activity with different divalent cations, given ArnC is a metal-dependent glycosyltransferase .

  • Inhibition assays: Testing potential inhibitors and determining IC50 values.

For reliable results, researchers should ensure adequate solubilization of membrane components using appropriate detergents and consider nanodiscs or similar technologies for maintaining native-like membrane environments during assays.

How can researchers address phenotypic inconsistencies between in vitro and in vivo studies of arnC function?

When facing discrepancies between in vitro and in vivo results regarding arnC function:

  • Evaluate growth conditions: In vitro conditions may not activate the regulatory pathways that control arnC expression in vivo. Try mimicking in vivo conditions by adjusting pH, nutrient availability, and adding sub-inhibitory concentrations of antimicrobial peptides.

  • Consider regulatory networks: The expression of arnC may be controlled by complex regulatory networks including PhoP/PhoQ and other two-component systems. Investigate the activation state of these regulators in both settings .

  • Examine pleiotropy: The Ugd enzyme has been shown to have pleiotropic effects in E. ictaluri, influencing not only LPS synthesis but also bacterial motility . Similarly, arnC modifications may have broader impacts than anticipated.

  • Assess host immune interactions: In vivo, host immune responses may alter bacterial gene expression patterns. Co-culture experiments with fish immune cells may provide intermediate data points.

  • Implement tissue-specific recovery techniques: For in vivo studies, develop methods to isolate bacteria from specific host tissues to better understand microenvironment effects on gene expression.

If inconsistencies persist, consider developing site-specific reporter systems that can monitor gene expression and protein localization in real-time during infection.

What statistical approaches are most appropriate for analyzing protective efficacy data from recombinant E. ictaluri vaccine trials?

When analyzing protective efficacy data from vaccine trials, researchers should employ:

  • Survival analysis: Kaplan-Meier survival curves with log-rank tests to compare survival rates between vaccinated and control groups over time.

  • Relative percent survival (RPS) calculation: Using the formula:
    RPS=(1%mortality in vaccinated fish%mortality in controls)×100%RPS = (1 - \frac{\% \text{mortality in vaccinated fish}}{\% \text{mortality in controls}}) \times 100\%

  • Mixed-effects models: For longitudinal data accounting for both fixed factors (vaccination status, challenge strain) and random effects (tank effects, fish family).

  • Sample size determination: Power analysis to ensure adequate sample sizes based on expected effect sizes (typically aim for 80% power with alpha=0.05).

  • Multiple comparison corrections: When testing multiple vaccine formulations or challenge strains, implement Bonferroni or false discovery rate corrections.

  • Non-parametric alternatives: When data violate normality assumptions, use Mann-Whitney U or Kruskal-Wallis tests.

For comprehensive analysis, complement survival data with immunological parameters (antibody titers, gene expression) using correlation analyses to identify potential correlates of protection.

How should researchers interpret conflicting results regarding arnC expression patterns under different experimental conditions?

When faced with conflicting results about arnC expression patterns:

  • Standardize RNA extraction protocols: Ensure consistency in cell harvesting time points, growth phase (preferably late-exponential phase, OD600 ~0.85) , and RNA preservation methods.

  • Validate reference genes: Confirm stability of reference genes (such as 16S rRNA) under all experimental conditions, using multiple references when possible .

  • Consider post-transcriptional regulation: Complement mRNA expression data with protein levels through western blotting or mass spectrometry.

  • Examine environmental triggers: Systematically test environmental factors known to influence antimicrobial resistance gene expression:

    • pH changes

    • Divalent cation (Mg2+, Ca2+) availability

    • Presence of sub-inhibitory antimicrobial concentrations

    • Growth phase differences

  • Investigate strain-specific variations: Compare reference strains with clinical or environmental isolates to identify strain-specific regulatory differences.

  • Implement time-course studies: Single time-point analyses may miss expression dynamics; examine expression patterns across multiple time points.

If conflicts persist, consider global approaches such as RNA-seq to identify potential regulatory networks or compensatory pathways that might explain the observed differences in arnC expression.

What potential applications exist for engineered E. ictaluri strains with modified arnC expression beyond aquaculture vaccines?

Engineered E. ictaluri strains with modified arnC expression offer several promising research applications:

  • Delivery vectors for heterologous antigens: The E. ictaluri vaccine platform could be adapted to express and deliver antigens from viral or parasitic pathogens affecting aquaculture .

  • DNA vaccine delivery systems: The bacterial vector could be engineered to deliver plasmid DNA vaccines to host cells, providing an alternative delivery mechanism for genetic immunization .

  • Fundamental research tools: These strains can serve as models for studying host-pathogen interactions and immune response development in fish.

  • Environmental biosensors: Modified strains could be developed as biosensors for detecting antimicrobial compounds in aquatic environments.

  • Adjuvant development platform: Components of the LPS modification pathway could be harnessed to develop novel adjuvants for fish vaccines.

When pursuing these applications, researchers should maintain focus on biocontainment strategies such as the programmed self-lysis after 5-10 cell divisions to ensure environmental safety .

How might structural knowledge of ArnC inform the development of novel antimicrobial strategies?

Recent structural insights into ArnC provide several avenues for antimicrobial development:

  • Structure-based inhibitor design: The cryo-electron microscopy structures of ArnC in apo and nucleotide-bound conformations reveal specific binding pockets that can be targeted by small molecule inhibitors .

  • Conformational transition targeting: By understanding the conformational changes that occur upon substrate binding, researchers can design molecules that lock the enzyme in non-catalytic conformations .

  • Combination therapy approaches: ArnC inhibitors could potentially resensitize resistant bacteria to existing polymyxin antibiotics, providing valuable combination therapy options.

  • Broad-spectrum applications: Since the catalytic mechanism is likely conserved across metal-dependent polyprenyl phosphate glycosyltransferases, inhibitors may have activity against multiple bacterial species .

  • Peptidomimetic development: Designing molecules that mimic cationic antimicrobial peptides but resist the modifications mediated by arnC and related enzymes.

Researchers should pursue computational approaches including molecular dynamics simulations to further understand substrate coordination and identify transient binding pockets that may not be evident in static structures .

How could CRISPR-Cas systems be applied to study arnC function in E. ictaluri?

CRISPR-Cas technologies offer powerful new approaches to study arnC function:

  • Precise gene editing: CRISPR-Cas9 could generate clean deletions or point mutations in arnC without polar effects on adjacent genes, improving upon traditional allelic exchange methods .

  • CRISPRi for conditional knockdowns: dCas9-based transcriptional repression systems could allow titratable reduction in arnC expression without complete gene deletion.

  • CRISPRa for overexpression studies: dCas9-based activation systems could upregulate arnC expression to study the effects of increased enzyme levels.

  • Base editing applications: CRISPR base editors could introduce specific amino acid changes to study structure-function relationships without complete gene disruption.

  • High-throughput screening: CRISPR libraries targeting genes in the arnC pathway could identify new components involved in antimicrobial resistance.

  • In vivo tracking: Combining CRISPR with fluorescent reporters could allow real-time monitoring of arnC expression during infection.

When implementing these approaches, researchers should optimize CRISPR-Cas delivery methods for E. ictaluri, potentially using the arabinose-inducible system (araC PBAD) that has been successful with other genetic modifications in this organism .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.