Recombinant Edwardsiella ictaluri Universal stress protein B (uspB)

What is Edwardsiella ictaluri Universal stress protein B (uspB) and what is its significance in bacterial pathogenesis?

Universal stress protein B (uspB) is one of several universal stress proteins identified in the genome of Edwardsiella ictaluri, a Gram-negative facultative pathogen responsible for enteric septicemia of catfish (ESC). This economically significant disease causes substantial losses in the U.S. catfish industry . The uspB protein contributes to E. ictaluri's ability to survive under various stress conditions encountered during host infection.

The amino acid sequence of uspB is: MINTVALF WALFIVCCVVNMLRYYSSLLRALLVVLRGCDPLLYQYVDGGGFFTSHGQPGKQLRLVRYIYERRYCDHHD GEFIRRCERL RRQFILTSALCGLVVVALI ALMLWH . This protein is part of a broader family of universal stress proteins that are upregulated during environmental stressors, particularly acidic conditions and oxidative stress, which are relevant to the intracellular lifestyle of this pathogen .

How are universal stress proteins functionally categorized in E. ictaluri and how does uspB fit within this classification?

E. ictaluri contains at least 13 universal stress proteins that are scattered throughout its chromosome with no operon structure observed . These USPs can be functionally categorized based on their contributions to:

While the search results don't specifically categorize uspB by function, the general pattern indicates that different USPs play specialized roles in stress response and virulence . The specific contribution of uspB would need to be determined through targeted deletion studies similar to those performed for other USPs.

What experimental approaches are most effective for studying uspB expression under various environmental conditions?

The most effective experimental approaches for studying uspB expression combine molecular techniques with physiological stress assays:

Recommended Methodological Workflow:

• Bioluminescent reporter systems: Construct bioluminescent strains using plasmids like pAKgfplux1 to quantitatively measure gene expression in real-time .

• Stress exposure assays: Subject bacteria to defined stressors (pH 5.5 for acid stress, 0.1% H₂O₂ for oxidative stress) and measure growth differences using optical density and bioluminescence .

• In-frame deletion mutants: Create targeted gene knockouts using overlap extension PCR and allelic exchange, followed by phenotypic characterization .

• Comparative growth kinetics: Monitor growth over 24 hours, taking measurements at 2, 4, 8, 12, and 20-hour intervals under various conditions .

These techniques allow researchers to correlate uspB expression with specific environmental triggers and to determine the functional consequences of gene deletion.

How do deletion mutations in uspB affect E. ictaluri survival under acidic and oxidative stress conditions?

While the search results don't specifically report the effects of uspB deletion, they provide a comprehensive framework for understanding how USP deletions generally affect stress responses in E. ictaluri:

Effect of USP Deletions on Stress Tolerance:

Acidic Stress Response (pH 5.5):
All tested USP mutants showed significant growth reduction under acidic conditions. The susceptibility ranked from highest to lowest as follows: Δusp03 > Δusp07 > Δusp13 > Δusp09 > Δusp10 > Δusp08 > Δusp06 > Δusp04 > Δusp05 > Δusp02 .

Oxidative Stress Response (0.1% H₂O₂):
EiΔusp05 and EiΔusp08 exhibited particularly high sensitivity to oxidative stress, suggesting their crucial role in managing reactive oxygen species during infection .

These findings indicate that the deletion of uspB would likely compromise bacterial survival under stress conditions, though the magnitude of effect would need to be determined experimentally.

What are the optimal conditions for recombinant expression and purification of uspB protein?

Based on available information about recombinant uspB production:

Optimal Expression and Purification Protocol:

• Expression system: While not explicitly stated in the search results, recombinant proteins are typically expressed in E. coli systems with appropriate tagging for purification.

• Purification approach: The tag type should be determined during the production process to optimize yield and stability .

• Buffer composition: Store purified protein in Tris-based buffer with 50% glycerol, specifically optimized for uspB stability .

• Storage conditions:

  • Long-term storage: -20°C or -80°C

  • Working aliquots: 4°C for up to one week

  • Note: Repeated freezing and thawing is not recommended due to potential protein degradation

• Quality control: Verify protein identity through mass spectrometry and functional assays before experimental use.

How can recombinant uspB be utilized in developing vaccines against enteric septicemia of catfish?

Recombinant uspB has significant potential in vaccine development strategies against ESC:

Vaccine Development Approaches:

• Live attenuated vaccines: Several USP deletion mutants (EiΔusp05, EiΔusp07, EiΔusp08, EiΔusp09, EiΔusp10, and EiΔusp13) demonstrated significant attenuation in virulence studies, with mortality rates ranging from 10-55% compared to 74.1% with wild-type E. ictaluri .

• Efficacy data: Vaccination of catfish fingerlings with these attenuated strains provided complete protection against wild-type challenge, compared to 58.33% mortality in sham-vaccinated fish .

• Recombinant subunit vaccines: Purified recombinant uspB could be formulated as a subunit vaccine, potentially in combination with other immunogenic proteins.

• Immune response evaluation: Vaccine candidates should be assessed for their ability to induce both humoral and cell-mediated immunity in catfish.

What technical challenges exist in working with recombinant uspB and how can they be overcome?

Several technical challenges may be encountered when working with recombinant uspB:

Common Challenges and Solutions:

• Protein stability issues:

  • Challenge: Recombinant uspB may have limited stability after purification

  • Solution: Optimize buffer conditions with 50% glycerol and avoid repeated freeze-thaw cycles

• Functional assays:

  • Challenge: Determining if recombinant protein maintains native function

  • Solution: Develop stress-response assays that can measure complementation of uspB mutants

• Antigenicity preservation:

  • Challenge: Ensuring recombinant protein maintains proper folding and epitope presentation

  • Solution: Compare antibody recognition between native and recombinant forms

• Expression yield optimization:

  • Challenge: Achieving sufficient quantities for experimental use

  • Solution: Optimize codon usage for expression host and evaluate different fusion tags

How do uspB expression patterns differ between virulent and attenuated strains of E. ictaluri?

While the search results don't specifically address uspB expression differences between virulent and attenuated strains, we can draw insights from related findings:

Research on other USPs in E. ictaluri has shown significant expression differences under stress conditions. For example, usp07 (KdpD) showed very high expression levels after host stress exposure . This suggests that:

• Virulent strains likely upregulate uspB expression under host-relevant stress conditions

• Attenuated strains may have altered regulation of uspB

• Expression patterns would likely differ in response to:

  • Acidic pH environments (similar to phagosomal conditions)

  • Oxidative stress (mimicking host immune responses)

  • Nutrient limitation (resembling intracellular environments)

A comprehensive gene expression study comparing uspB levels between virulent and attenuated strains under various stress conditions would provide valuable insights into its role in pathogenesis.

What methodological approaches are most effective for studying protein-protein interactions involving uspB?

To effectively study protein-protein interactions involving uspB, researchers should consider these methodological approaches:

Recommended Interaction Study Methods:

• Co-immunoprecipitation (Co-IP):

  • Utilize antibodies against uspB to pull down interacting proteins

  • Identify binding partners through mass spectrometry

• Bacterial two-hybrid systems:

  • Adapt yeast two-hybrid methodology for bacterial protein interactions

  • Screen for potential binding partners from E. ictaluri proteome

• Surface plasmon resonance (SPR):

  • Quantitatively measure binding kinetics between uspB and potential partners

  • Determine binding affinity constants

• Crosslinking coupled with mass spectrometry:

  • Capture transient interactions through chemical crosslinking

  • Identify interaction sites at amino acid resolution

• In silico prediction and verification:

  • Use computational methods to predict potential binding partners

  • Verify experimentally using above techniques

What is the relationship between uspB expression and catfish immune response during infection?

The relationship between uspB expression and catfish immune response represents an important area for investigation. Based on available data:

• Virulence attenuation: USP deletion mutants show significantly reduced virulence in catfish, suggesting they play a role in counteracting host immune responses .

• Protective immunity: Vaccination with USP mutants provides complete protection against wild-type challenge, indicating they elicit effective adaptive immune responses .

• Stress adaptation: The sensitivity of USP mutants to acidic and oxidative stress suggests they help bacteria resist similar stressors encountered during immune cell phagocytosis .

• Host response modulation: The role of uspB specifically in modulating host responses could be studied by:

  • Comparing cytokine profiles in catfish infected with wild-type versus uspB-deficient E. ictaluri

  • Assessing differences in immune cell activation and recruitment

  • Examining bacterial survival in macrophages

How does the structure of uspB contribute to its function in stress response?

While detailed structural information for uspB is not provided in the search results, we can make informed inferences:

The amino acid sequence of uspB (MINTVALF WALFIVCCVVNMLRYYSSLLRALLVVLRGCDPLLYQYVDGGGFFTSHGQPGKQLRLVRYIYERRYCDHHD GEFIRRCERL RRQFILTSALCGLVVVALI ALMLWH) suggests:

• Transmembrane domains: The presence of hydrophobic stretches indicates potential membrane association, which may be important for sensing environmental stressors.

• Conserved domains: USPs typically contain ATP-binding motifs that enable them to function in signaling pathways responding to environmental stress.

• Structure-function relationship: The ability of uspB to contribute to stress response likely depends on:

  • Proper folding in the bacterial membrane

  • Interaction with other stress response proteins

  • Potential oligomerization under stress conditions

Further structural studies using X-ray crystallography or cryo-electron microscopy would provide valuable insights into the molecular mechanisms underlying uspB function.

What evolutionary relationships exist between E. ictaluri uspB and stress proteins in other pathogenic bacteria?

Though the search results don't directly address evolutionary relationships, universal stress proteins are widely conserved across bacterial species:

• Conservation pattern: USPs like uspB represent ancient and evolutionarily conserved stress response mechanisms in bacteria.

• Functional analogs: Similar proteins in other pathogens include:

  • KdpD in Salmonella typhimurium, which promotes resistance to osmotic, oxidative, and antimicrobial stresses

  • USPs in Mycobacterium tuberculosis that play roles in latency and persistence during chronic infection

  • USPs in Listeria monocytogenes that contribute to acid stress response

• Divergent functions: Despite structural conservation, USPs have evolved specialized functions in different bacterial species:

  • Some primarily respond to acidic stress

  • Others are more important for oxidative stress resistance

  • Some contribute directly to virulence while others do not

Comparative genomic and functional studies would provide deeper insights into how E. ictaluri uspB has evolved within the broader context of bacterial stress responses.

How can high-throughput screening methods be applied to identify inhibitors of uspB function?

High-throughput screening for uspB inhibitors could follow this methodological framework:

Screening Strategy:

• Target-based assays:

  • Develop in vitro assays measuring uspB activity (potentially ATP binding)

  • Screen chemical libraries for compounds that inhibit this activity

• Phenotypic screening:

  • Create reporter strains with fluorescent/luminescent markers linked to uspB function

  • Screen for compounds that reduce signal under stress conditions

• Computational approaches:

  • Use the inferred structure of uspB to conduct virtual screening

  • Identify compounds predicted to bind critical functional domains

• Validation cascade:

  • Primary hits confirmed in dose-response assays

  • Secondary validation in bacterial stress resistance assays

  • Tertiary validation in infection models

• Lead optimization:

  • Structure-activity relationship studies to improve potency and selectivity

  • Pharmacokinetic optimization for potential therapeutic applications

This approach could identify novel compounds with potential as antimicrobial agents specifically targeting E. ictaluri infections in aquaculture.

What role does uspB play in E. ictaluri biofilm formation and persistence in aquatic environments?

While the search results don't directly address uspB's role in biofilm formation, we can propose investigative approaches:

Stress response proteins often contribute to bacterial persistence in hostile environments, including biofilm formation. To investigate uspB's role:

• Comparative biofilm assays:

  • Compare biofilm formation between wild-type and uspB-deficient strains

  • Assess biofilm architecture using confocal microscopy

  • Quantify differences in biofilm biomass and viability

• Environmental persistence studies:

  • Evaluate survival of uspB mutants in aquatic environments mimicking catfish ponds

  • Assess persistence under fluctuating temperature, pH, and nutrient conditions

• Gene expression analysis:

  • Measure uspB expression during different stages of biofilm development

  • Identify environmental triggers that modulate expression

This research direction would provide valuable insights into the ecological aspects of E. ictaluri persistence relevant to aquaculture settings.

How can CRISPR-Cas9 technology be utilized to study uspB function in E. ictaluri?

CRISPR-Cas9 technology offers powerful approaches for studying uspB function:

CRISPR-Based Methodological Framework:

• Precise gene editing:

  • Create clean deletions of uspB without polar effects on neighboring genes

  • Introduce point mutations to study specific functional domains

  • Engineer reporter fusions at the native locus

• Transcriptional modulation:

  • Use CRISPR interference (CRISPRi) to downregulate uspB expression without deletion

  • Apply CRISPR activation (CRISPRa) to upregulate expression in specific conditions

• High-throughput functional genomics:

  • Create CRISPR libraries targeting genes potentially interacting with uspB

  • Screen for genetic interactions under various stress conditions

• In vivo applications:

  • Develop systems for inducible gene manipulation during infection

  • Study temporal aspects of uspB function during pathogenesis

These approaches would provide unprecedented insights into uspB function with greater precision than conventional genetic methods used in the current literature .