Recombinant Edwardsiella ictaluri UPF0208 membrane protein NT01EI_2692 (NT01EI_2692)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Edwardsiella ictaluri UPF0208 membrane protein NT01EI_2692 (NT01EI_2692) is a protein expressed by the bacterium Edwardsiella ictaluri, which is a Gram-negative facultative pathogen that causes enteric septicemia of catfish (ESC) . ESC is a common disease that results in substantial economic losses in the U.S. catfish industry .

Product Information :

  • Product Code: CSB-MP511592EJO1

  • Uniprot No.: C5B8J9

  • Target Names: NT01EI_2692

  • Protein Names: UPF0208 membrane protein NT01EI_2692

  • Immunogen Species: Edwardsiella ictaluri (strain 93-146)

  • Source: Mammalian cell

  • Purity: >85% (SDS-PAGE)

  • Protein Length: Partial

Biological Role of Edwardsiella ictaluri

Edwardsiella ictaluri is an intracellular pathogen . Research has shown that several universal stress proteins (USPs) are highly expressed under in vitro and in vivo stress conditions, suggesting their importance for E. ictaluri survival .

Universal Stress Proteins (USPs) and Virulence

Studies indicate that USPs contribute to the virulence of E. ictaluri in catfish . Several usp genes of E. ictaluri have been deleted and characterized, showing that USP mutants are sensitive to acidic conditions . Additionally, certain mutants are very sensitive to oxidative stress . Virulence studies have demonstrated that several USP mutants are significantly attenuated compared to the wild-type E. ictaluri .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
NT01EI_2692; UPF0208 membrane protein NT01EI_2692
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Edwardsiella ictaluri (strain 93-146)
Target Names
NT01EI_2692
Target Protein Sequence
MSSAPTPHVAWFRLFQRGQIYMKTWPNEKRLAPVFPENRVTRATRFAIRFMPPIAMFTLC WQIALGGQLGPAIATALFACSLPMQGLWWLGKRAVTPLPPTLLQWFHQLRDKLQASGIAL APVDGAPTYQSLAELLRRCCKQLDKTFLDDI
Uniprot No.

Target Background

Database Links
Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

The foundation of any scientific investigation into NT01EI_2692 requires understanding the fundamentals of this membrane protein within its biological context. E. ictaluri is a gram-negative fish pathogen causing enteric septicemia in catfish, making it a significant concern for aquaculture research. The UPF0208 family of membrane proteins, to which NT01EI_2692 belongs, represents an uncharacterized protein family with emerging importance in bacterial physiology. Researchers beginning work with this protein need to establish basic knowledge about its characteristics, expression systems, and relationship to bacterial pathogenesis.

What is the UPF0208 membrane protein NT01EI_2692 and what is its role in Edwardsiella ictaluri?

UPF0208 membrane protein NT01EI_2692 is an uncharacterized protein family 0208 (UPF0208) member found in Edwardsiella ictaluri, a gram-negative fish pathogen that causes enteric septicemia in catfish. While the specific function of NT01EI_2692 is not fully elucidated, it belongs to a class of membrane proteins that typically play roles in cellular processes such as transport, signaling, or maintaining membrane integrity. In E. ictaluri, this protein may contribute to the bacterium's pathogenicity, survival in host environments, or membrane structure. Understanding this protein is important because E. ictaluri is a significant pathogen in the catfish aquaculture industry, and knowledge of its membrane proteins could lead to development of targeted interventions or vaccines . Similar UPF0208 proteins in other bacteria, like YfbV in Photorhabdus temperata, have been studied at the structural level, suggesting conserved functions across bacterial species .

What expression systems are recommended for recombinant production of NT01EI_2692?

For recombinant production of NT01EI_2692, several expression systems can be considered, each with distinct advantages. E. coli-based expression systems are commonly used for initial attempts due to their simplicity and high yield, but may present challenges for membrane proteins. When expressing NT01EI_2692 in E. coli, consider using specialized strains designed for membrane protein expression, such as C41(DE3) or C43(DE3). Alternative systems include yeast (Pichia pastoris or Saccharomyces cerevisiae), which can provide a more suitable eukaryotic-like membrane environment. For NT01EI_2692 specifically, an asdA-based balanced-lethal system within E. ictaluri itself may be advantageous, as it allows expression in the native host environment . This approach involves using a ΔasdA mutant strain complemented with an Asd+ plasmid carrying the NT01EI_2692 gene. Temperature optimization is critical, with expression typically performed at 16-20°C to slow production and allow proper folding. Fusion tags such as His6, MBP, or SUMO can improve solubility and facilitate purification, but should be carefully selected based on downstream applications .

How can I confirm the full-length expression and proper folding of recombinant NT01EI_2692?

Confirming full-length expression and proper folding of recombinant NT01EI_2692 requires a multi-faceted approach. First, utilize SDS-PAGE analysis to verify the protein's molecular weight, comparing it to the theoretical weight calculated from its amino acid sequence. Western blotting with antibodies targeting either the native protein or fusion tags at both N and C termini can confirm full-length expression, as truncated products will be missing one of the terminal tags . For membrane proteins like NT01EI_2692, extraction methods significantly impact protein integrity; therefore, employ gentle detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) for solubilization. Protein folding can be assessed through circular dichroism (CD) spectroscopy to analyze secondary structure elements and thermal stability. Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) provides information on oligomeric state and homogeneity. Functional assays, though challenging without known function, might include binding studies with potential ligands or interaction partners identified through bioinformatic analysis of UPF0208 family proteins. When possible, limited proteolysis can provide evidence of a well-folded structure, as properly folded proteins typically show resistance to digestion at specific sites .

What are the predicted structural features of NT01EI_2692 based on bioinformatic analysis?

Bioinformatic analysis of NT01EI_2692 reveals several key structural features characteristic of UPF0208 family membrane proteins. Transmembrane topology prediction algorithms suggest that NT01EI_2692 likely contains multiple membrane-spanning alpha-helical domains, similar to other UPF0208 family members. Comparative analysis with the structurally characterized UPF0208 membrane protein YfbV from Photorhabdus temperata (which has a global pLDDT confidence score of 81.86 according to AlphaFold predictions) indicates a predominantly alpha-helical structure with confident structural predictions (pLDDT >70) for the core regions . Hydrophobicity analysis reveals distinctive hydrophobic segments consistent with transmembrane domains, while conserved motifs identified through multiple sequence alignment across the UPF0208 family suggest functional sites potentially involved in protein-protein interactions or substrate binding. Secondary structure prediction indicates a mix of alpha-helical regions (primarily in the transmembrane segments) and connecting loops. Post-translational modification sites may be present based on sequence motif analysis, though experimental verification would be necessary to confirm these predictions. Given the increasing accuracy of structure prediction tools like AlphaFold, a computational model of NT01EI_2692 would likely provide valuable insights into its three-dimensional arrangement and potential functional sites .

Advanced Research Questions

Advanced investigation of NT01EI_2692 involves sophisticated experimental approaches and deeper conceptual understanding of protein function in the context of E. ictaluri pathogenesis. These questions address complex aspects of protein-protein interactions, structure-function relationships, and applications in vaccine development. Researchers pursuing these topics should be familiar with advanced molecular biology techniques, structural biology methodologies, and the principles of bacterial pathogenesis and immunology.

How can the balanced-lethal system be optimized for NT01EI_2692 expression in vaccine development?

Optimizing the balanced-lethal system for NT01EI_2692 expression in vaccine development requires strategic manipulation of multiple parameters. The asdA-based balanced-lethal system established for E. ictaluri provides an excellent foundation, as it creates antibiotic-free plasmid maintenance through complementation of the chromosomal ΔasdA mutation with an Asd+ plasmid carrying NT01EI_2692 . To enhance this system, first consider plasmid copy number optimization—moderate copy number vectors often provide optimal expression levels for membrane proteins without imposing excessive metabolic burden. The promoter system should be carefully selected; while constitutive promoters ensure continuous expression, inducible systems like the arabinose-inducible araBAD promoter allow tight regulation of expression timing and level. To address the challenges of membrane protein expression, incorporate specialized elements such as heat shock protein (HSP) co-expression or cold-shock expression systems. For vaccine applications specifically, design constructs that present immunodominant epitopes of NT01EI_2692 on the bacterial surface by creating chimeric proteins with outer membrane proteins. The compatibility of Asd+ vectors with native E. ictaluri plasmids (pEI1 and pEI2) should be leveraged to create multi-antigen expression systems . Codon optimization based on E. ictaluri preferences can significantly enhance expression levels, while incorporating stabilizing mutations identified through directed evolution approaches may improve protein yield and immunogenicity in vaccine formulations.

What protein-protein interactions might NT01EI_2692 engage in, and how can they be identified?

NT01EI_2692, as a membrane protein in E. ictaluri, likely participates in multiple protein-protein interactions (PPIs) that are critical to its cellular function and potential role in pathogenesis. These interactions might include associations with other membrane proteins, periplasmic partners, or cytoplasmic signaling components. To comprehensively identify these interactions, a multi-method approach is recommended. Bacterial two-hybrid systems, particularly those adapted for membrane proteins like BACTH (Bacterial Adenylate Cyclase Two-Hybrid), can screen for binary interactions in vivo. For more extensive interaction mapping, proximity-dependent biotin identification (BioID) or APEX2-based proximity labeling can be employed by fusing these enzymes to NT01EI_2692, allowing biotinylation of nearby proteins that can subsequently be identified by mass spectrometry . Co-immunoprecipitation coupled with crosslinking is particularly valuable for capturing transient interactions, while blue native PAGE can preserve native protein complexes. Surface plasmon resonance (SPR) or microscale thermophoresis (MST) provide quantitative binding parameters for confirmed interactions. Computational approaches, including co-expression analysis of E. ictaluri transcriptomic data and structural docking based on AlphaFold models, can guide experimental efforts . Functional validation of identified interactions should be pursued through mutagenesis of interaction interfaces followed by phenotypic analysis in E. ictaluri infection models to establish biological relevance in pathogenesis.

How does the structure-function relationship of NT01EI_2692 compare to other UPF0208 family proteins across bacterial species?

The structure-function relationship of NT01EI_2692 can be compared to other UPF0208 family proteins through comprehensive comparative analysis. UPF0208 proteins, including YfbV from Photorhabdus temperata, demonstrate notable structural conservation despite moderate sequence identity, suggesting evolutionary pressure to maintain specific functional elements . At the structural level, NT01EI_2692 likely shares the characteristic alpha-helical transmembrane domains observed in the Photorhabdus YfbV protein, which has a global pLDDT confidence score of 81.86 according to AlphaFold predictions . Sequence alignment across different bacterial species reveals conserved motifs concentrated in specific transmembrane segments and connecting loops, potentially corresponding to functional sites involved in transport, signaling, or protein-protein interactions. Structural variation typically occurs in extracellular or periplasmic loops, which may reflect species-specific adaptations related to pathogenicity or environmental niches. Computational analysis of surface electrostatic properties and conservation mapping onto 3D models can identify potential functional hotspots. Cross-species complementation experiments, where NT01EI_2692 is expressed in other bacteria with mutations in their UPF0208 homologs, would provide valuable functional insights. Differences in genomic context and predicted interaction partners between species may indicate functional divergence despite structural similarity . This comparative approach serves not only to elucidate NT01EI_2692's function but also to understand the broader evolutionary patterns within this uncharacterized protein family.

What role might NT01EI_2692 play in antimicrobial resistance or virulence of E. ictaluri?

NT01EI_2692, as a membrane protein in E. ictaluri, potentially contributes to antimicrobial resistance and virulence through several molecular mechanisms. As a membrane component, it may participate in maintaining membrane integrity under stress conditions induced by antimicrobials, particularly those targeting cell envelope structures. The protein could function within efflux pump complexes, contributing to the extrusion of antibiotics from bacterial cells, a common resistance mechanism in gram-negative pathogens. In terms of virulence, NT01EI_2692 might facilitate host colonization by mediating adhesion to fish tissues or by sensing environmental cues that trigger virulence gene expression. Its potential role in biofilm formation, a key feature of E. ictaluri persistence in aquatic environments and fish tissues, warrants investigation through biofilm assays comparing wild-type and NT01EI_2692 knockout strains . Transcriptomic analysis under infection-mimicking conditions could reveal co-expression patterns with known virulence factors. Experimental approaches to elucidate these functions include creating clean deletion mutants using the balanced-lethal system developed for E. ictaluri, followed by comprehensive phenotypic analysis including antimicrobial susceptibility testing, virulence assessment in fish models, and in vitro assays of adhesion, invasion, and intracellular survival . Comparative genomics across E. ictaluri strains with varying virulence profiles may highlight NT01EI_2692 sequence variations correlating with pathogenicity, providing insights into structure-function relationships relevant to vaccine development.

Methodological Approaches

Effective research on NT01EI_2692 requires specialized methodologies tailored to the challenges of membrane protein biochemistry and the specific characteristics of E. ictaluri. This section addresses experimental design considerations, optimization strategies, and innovative techniques applicable to this research area. The methodological approaches span from protein expression and purification to functional characterization and application in vaccine development.

What purification strategy would yield the highest quality NT01EI_2692 for structural studies?

A high-quality purification strategy for NT01EI_2692 structural studies begins with optimized expression conditions to maximize properly folded protein yield. Following expression in an appropriate system such as C41(DE3) E. coli or the E. ictaluri balanced-lethal system, cells should be disrupted using methods that preserve membrane protein integrity, such as gentle mechanical disruption or enzymatic lysis . The critical first step involves membrane fraction isolation through differential centrifugation, followed by solubilization using a detergent screening approach to identify optimal conditions. For UPF0208 family membrane proteins, mild detergents such as n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin often preserve native structure while effectively solubilizing membrane components. Multi-step chromatography, beginning with immobilized metal affinity chromatography (IMAC) using a His6-tag, followed by size exclusion chromatography (SEC) to remove aggregates and ensure monodispersity, forms the backbone of the purification strategy . For challenging membrane proteins like NT01EI_2692, consideration of amphipols or nanodiscs for detergent exchange during later purification stages can enhance stability. Quality assessment at each purification step using techniques such as dynamic light scattering and thermal stability assays helps monitor protein behavior. For structural studies specifically, final protein quality should be verified through negative-stain electron microscopy prior to cryo-EM or crystallization attempts. Throughout the process, maintaining cold temperatures (4°C) and including appropriate protease inhibitors is essential to prevent degradation .

How can I design effective in vivo experiments to study NT01EI_2692 function in E. ictaluri pathogenesis?

Designing effective in vivo experiments to study NT01EI_2692 function in E. ictaluri pathogenesis requires a comprehensive approach centered on relevant animal models. Channel catfish (Ictalurus punctatus) represent the most physiologically relevant model, as they are the natural host for E. ictaluri infection. Begin by creating precise gene knockouts of NT01EI_2692 using CRISPR-Cas9 or traditional homologous recombination methods, alongside complemented strains and point mutants affecting specific predicted functional domains. The balanced-lethal system utilizing ΔasdA E. ictaluri strains provides an excellent platform for generating stable complementation strains without antibiotic selection pressure, which could confound infection studies . Experimental design should include multiple infection routes (immersion, injection, and oral) to comprehensively assess pathogenesis, with careful monitoring of bacterial burden in tissues, histopathological changes, and survival rates. Molecular markers of fish immune response should be measured through techniques such as qPCR for cytokine expression or immunohistochemistry for immune cell infiltration. For mechanistic insights, ex vivo studies using primary catfish cells or tissue explants can bridge in vitro and in vivo approaches. Tissue-specific colonization patterns can be visualized using reporter strains expressing fluorescent proteins from the balanced-lethal plasmid system . Competition assays between wild-type and NT01EI_2692 mutant strains provide sensitive measures of fitness defects. Throughout these studies, careful attention to animal welfare, statistical power calculations for determining appropriate sample sizes, and controls for environmental variables is essential for generating reliable, reproducible data on NT01EI_2692's role in pathogenesis.

What are the best approaches for analyzing membrane topology and orientation of NT01EI_2692?

Analyzing the membrane topology and orientation of NT01EI_2692 requires a multi-faceted experimental approach that combines biochemical, genetic, and structural methods. A primary strategy is the reporter fusion technique, where reporter enzymes such as alkaline phosphatase (PhoA) or green fluorescent protein (GFP) are fused to different positions within the NT01EI_2692 sequence. PhoA is only active when located in the periplasm, while GFP fluorescence is quenched in the periplasm, making them complementary tools for topology mapping . Cysteine scanning mutagenesis combined with selective labeling using membrane-permeable and -impermeable sulfhydryl reagents provides detailed information about residue accessibility. For higher resolution analysis, mass spectrometry-based approaches such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) or limited proteolysis coupled with MS can identify protected regions embedded in the membrane. Surface biotinylation followed by mass spectrometry identifies exposed regions. Computational predictions using algorithms specifically designed for membrane proteins (e.g., TMHMM, Phobius) provide theoretical models that guide experimental design and interpretation . Cryo-electron microscopy of 2D crystals or advanced AFM techniques can directly visualize the protein's arrangement in membranes. For in vivo confirmation in E. ictaluri, fluorescence microscopy using split-GFP complementation systems can verify predicted topological models. Integration of these multiple lines of evidence provides a comprehensive and reliable topological map essential for understanding NT01EI_2692's structure-function relationships and for rational design of vaccines targeting extracellular epitopes .

How can computational approaches accelerate research on NT01EI_2692 structure and function?

Computational approaches offer powerful tools to accelerate research on NT01EI_2692 structure and function through multiple avenues. Structure prediction using AlphaFold2 or RoseTTAFold provides detailed 3D models with confidence metrics (pLDDT scores) for different regions, as demonstrated for similar UPF0208 family proteins like YfbV . These models can immediately guide experimental design by identifying potential functional sites and informing mutagenesis strategies. Molecular dynamics simulations in explicit membrane environments reveal dynamic behaviors and conformational changes that may be critical for function. Computational docking studies can predict interactions with potential ligands, substrates, or protein partners, narrowing the experimental search space. For functional annotation, advanced homology detection methods like HHpred can identify distant relationships to functionally characterized proteins that might be missed by standard BLAST searches. Genomic context analysis examining gene neighborhood conservation across bacteria provides clues about functional associations and potential pathways involving NT01EI_2692. Protein-protein interaction networks reconstructed from various bacterial datasets can be used to predict E. ictaluri-specific interactions through interolog mapping. Epitope prediction algorithms help identify surface-exposed regions for vaccine development, while molecular evolution analyses (dN/dS ratios, conservation mapping) highlight functionally important residues under selective pressure. Integration of transcriptomic data from E. ictaluri under different conditions with these structural predictions can link structure to context-specific expression patterns. These computational approaches not only generate testable hypotheses but also optimize resource allocation for subsequent experimental validation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.