Recombinant Edwardsiella ictaluri UPF0266 membrane protein NT01EI_1718 (NT01EI_1718)

Shipped with Ice Packs
In Stock

Description

Overview and Basic Characteristics

Recombinant Edwardsiella ictaluri UPF0266 membrane protein NT01EI_1718 is a genetically engineered protein derived from the bacterial species Edwardsiella ictaluri, a pathogen causing enteric septicemia in catfish. This protein belongs to the UPF0266 family, a group of uncharacterized proteins annotated in microbial genomes. Key features include:

PropertyDetails
Gene NameNT01EI_1718
Uniprot IDC5BDX6
Protein LengthFull-length (1-156 amino acids) or partial (exact residues vary)
Expression HostE. coli (full-length) or mammalian cells (partial)
TagN-terminal His-tag (in E. coli variant)
FormLyophilized powder or liquid (50% glycerol)
Purity>90% (SDS-PAGE) for E. coli-derived; >85% for mammalian-derived variants

Host Systems and Expression

HostTagProtein LengthPurityKey Applications
E. coliHisFull-length>90%Structural studies, affinity purification
Mammalian cellsNAPartial>85%Functional assays, post-translational studies

Purification Steps:

  1. Affinity chromatography (His-tagged variants).

  2. SDS-PAGE verification to confirm molecular weight (~17 kDa) and purity .

Functional and Research Applications

While direct functional data for NT01EI_1718 is limited, its role as a membrane protein suggests potential involvement in:

  • Pathogen-host interactions: Modulation of bacterial membrane integrity or host cell signaling.

  • Vaccine development: As an antigen for immunogenicity studies.

  • Structural biology: X-ray crystallography or cryo-EM studies (challenges noted for membrane proteins) .

Interactions: No direct binding partners are reported, though Creative BioMart lists pathway associations requiring experimental validation .

Research Gaps and Future Directions

  1. Functional elucidation: Studies on NT01EI_1718’s role in E. ictaluri pathogenesis remain unexplored.

  2. Membrane dynamics: Analysis of its interaction with T3SS effectors (e.g., EseN) could reveal novel virulence mechanisms .

  3. Structural resolution: High-resolution structures are needed to classify it as a transmembrane or monotopic IMP .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and arranged in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
NT01EI_1718; UPF0266 membrane protein NT01EI_1718
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Edwardsiella ictaluri (strain 93-146)
Target Names
NT01EI_1718
Target Protein Sequence
MSLTDIALLVFIVLFLLYAIYDEAIMPRQRSATLLRVNLKRRNKADSLIFIGLLAILVYR NISDQGAPFTTWLLATLMVVAIYIFYLRWPKLLFKQQGFYYGNVFIDYARIRGMNLSEDG FLVIDLEKRRLLIQVANLDSLDEIFKFLLEHQQKPA
Uniprot No.

Target Background

Database Links
Protein Families
UPF0266 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does NT01EI_1718 fit into our understanding of E. ictaluri pathogenesis?

The T3SS of E. ictaluri shows functional similarity to Salmonella pathogenicity island 2 T3SS and is required for replication in channel catfish head-kidney-derived macrophages (HKDM) . Expression of the T3SS is regulated by environmental conditions that mimic the phagosomal environment, including low pH and phosphate limitation . As a membrane protein, NT01EI_1718 may interact with these secretion systems or play a role in sensing environmental conditions relevant to pathogenesis.

What expression systems are optimal for producing recombinant NT01EI_1718?

Recombinant NT01EI_1718 has been successfully expressed in E. coli with an N-terminal His-tag . The commercial preparation described in the literature uses this system to produce the full-length protein (1-156 amino acids). When designing expression systems for membrane proteins like NT01EI_1718, researchers should consider:

Expression SystemAdvantagesConsiderations
E. coliFast growth, high yield, easy genetic manipulationMay need optimization for membrane protein folding
Cell-free systemsAvoids toxicity issues, direct access to reactionLower yields, higher cost
Yeast expressionBetter for eukaryotic membrane proteinsLonger production time
Insect cellsGood for complex membrane proteinsMore complex system, expensive

For laboratory-scale production, the E. coli system with appropriate membrane protein optimization (lower induction temperatures, specialized E. coli strains) appears sufficient for NT01EI_1718 expression .

What are the recommended storage and handling protocols for NT01EI_1718?

The recombinant NT01EI_1718 protein requires specific handling to maintain stability and functionality:

  • Storage: Store at -20°C/-80°C upon receipt.

  • Aliquoting: Divide into working aliquots to avoid repeated freeze-thaw cycles.

  • Buffer composition: Tris/PBS-based buffer with 6% Trehalose, pH 8.0.

  • Reconstitution: Centrifuge vial briefly before opening and reconstitute in deionized sterile water to 0.1-1.0 mg/mL.

  • Long-term storage: Add 5-50% glycerol (final concentration) and store at -20°C/-80°C.

  • Working stock: Store working aliquots at 4°C for up to one week .

These protocols help maintain protein integrity, which is particularly important for membrane proteins that tend to aggregate when improperly handled.

How can researchers investigate potential roles of NT01EI_1718 in virulence using mutagenesis approaches?

Investigating NT01EI_1718's role in virulence requires systematic mutagenesis approaches similar to those used for other E. ictaluri virulence factors:

  • In-frame deletion mutagenesis: Create precise deletions in the NT01EI_1718 gene using suicide vectors like pMEG-375 or pRE107 (containing sacB for counter-selection), as demonstrated for other E. ictaluri genes like evpB . This approach preserves reading frame and minimizes polar effects on downstream genes.

  • Complementation studies: Re-introduce the wild-type gene on a plasmid to confirm phenotypes are due to the targeted mutation rather than secondary effects.

  • Virulence assessment:

    • Intracellular replication assays in channel catfish head-kidney-derived macrophages (HKDM)

    • In vivo challenges in channel catfish or other susceptible species

    • Bacterial burden quantification in tissues

Previous studies with E. ictaluri regulatory genes have shown that mutations in key virulence regulators like esrA and esrB resulted in loss of ability to replicate in HKDM and full attenuation in channel catfish . Similar approaches could determine if NT01EI_1718 contributes to these phenotypes.

What methodologies are appropriate for determining NT01EI_1718 expression patterns during infection?

Understanding when and where NT01EI_1718 is expressed during infection requires:

  • Quantitative PCR (qPCR): Measure NT01EI_1718 transcript levels under various conditions, including:

    • Low pH environments (mimicking phagosomal conditions)

    • Phosphate limitation (another phagosomal condition)

    • Within infected macrophages or tissues

  • Reporter gene fusions: Fuse the NT01EI_1718 promoter to reporter genes like gfp or lux to monitor expression in real-time during infection.

  • Western blotting: Develop antibodies against NT01EI_1718 to detect protein levels under different conditions.

  • RNA-Seq analysis: Compare whole transcriptome profiles between wild-type and mutant strains under infection-relevant conditions.

Research has shown that E. ictaluri T3SS genes are expressed under low pH and phosphate limitation, conditions that mimic the phagosomal environment . Investigating whether NT01EI_1718 follows similar expression patterns would help establish its potential role in pathogenesis.

How might NT01EI_1718 interact with known E. ictaluri secretion systems?

To investigate potential interactions between NT01EI_1718 and E. ictaluri secretion systems:

  • Co-immunoprecipitation (Co-IP): Use antibodies against NT01EI_1718 to pull down potential interacting partners from bacterial lysates.

  • Bacterial two-hybrid assays: Screen for interactions between NT01EI_1718 and components of the T3SS or T6SS.

  • Localization studies: Use fluorescently tagged proteins to determine if NT01EI_1718 co-localizes with secretion system components.

  • Secretome analysis: Compare secreted proteins between wild-type and NT01EI_1718 mutant strains to identify any differences in secretion profiles.

E. ictaluri possesses both T3SS and T6SS that are critical for virulence. The T3SS is regulated by the EsrAB two-component system and the EsrC regulator . Additionally, E. ictaluri contains a 16-gene pathogenicity island encoding a T6SS with 80-99% amino acid identity to that of E. tarda . Determining whether NT01EI_1718 interacts with these systems could provide insights into its function.

What bioinformatic approaches can predict functional domains in NT01EI_1718?

Computational analysis of NT01EI_1718 can provide valuable insights:

  • Transmembrane topology prediction: Tools like TMHMM, Phobius, or TOPCONS to predict membrane-spanning regions.

  • Protein family analysis: Search for conserved domains using InterPro, Pfam, or CDD databases.

  • Structural homology modeling: Use tools like I-TASSER or AlphaFold to predict 3D structure based on homologous proteins.

  • Comparative genomics: Analyze NT01EI_1718 conservation across bacterial species and correlate with pathogenicity.

  • Protein-protein interaction prediction: Use tools like STRING to predict potential interaction partners.

A comprehensive bioinformatic approach combining these methods can generate testable hypotheses about NT01EI_1718 function that can be validated experimentally.

How does the regulatory network of E. ictaluri potentially influence NT01EI_1718 expression?

E. ictaluri possesses sophisticated regulatory systems that respond to environmental cues:

  • Two-component regulatory systems: The EsrAB system regulates T3SS gene expression in response to environmental signals like low pH and phosphate limitation . Experiments should test whether NT01EI_1718 is regulated by this or other two-component systems.

  • Transcription factor binding site analysis: Examine the promoter region of NT01EI_1718 for potential binding sites of known E. ictaluri transcription factors, including EsrB and EsrC.

  • Regulatory mutant studies: Compare NT01EI_1718 expression in wild-type bacteria versus regulatory mutants (esrA, esrB, esrC) under various conditions.

Research has shown that EsrB is the primary transcriptional regulator for E. ictaluri genes within the T3SS pathogenicity island, while EsrC regulates expression of plasmid-carried effectors and mediates coordinated expression of T6SS with T3SS . Determining if NT01EI_1718 is part of these regulons would provide insights into its potential role in virulence.

What cell culture models are appropriate for studying NT01EI_1718 function during host-pathogen interactions?

Appropriate cell culture models include:

  • Channel catfish head-kidney-derived macrophages (HKDM): The gold standard for E. ictaluri intracellular replication studies, as demonstrated in regulatory mutant studies .

  • Other fish cell lines: Cell lines derived from susceptible species like striped catfish (Pangasianodon hypophthalmus) may be valuable for comparative studies.

Cell ModelApplicationsKey Measurements
HKDMIntracellular replication, host responseBacterial counts, cytokine expression, cell viability
Fish epithelial cell linesAdherence, invasionAdherence efficiency, invasion rates
Fish embryonic cell linesGeneral pathogen-host interactionsCytopathic effects, gene expression

For intracellular replication assays, researchers typically infect HKDM with wild-type or mutant E. ictaluri strains and quantify intracellular bacteria at various time points post-infection . Similar approaches could be used to assess the impact of NT01EI_1718 mutations on intracellular survival and replication.

How can researchers determine if NT01EI_1718 is involved in antibiotic resistance mechanisms?

Given the identification of antibiotic resistance genes in E. ictaluri isolates, including the extended-spectrum β-lactamase CTX-M-15 , researchers might investigate NT01EI_1718's potential role in resistance:

  • Minimum inhibitory concentration (MIC) testing: Compare antibiotic susceptibility profiles between wild-type and NT01EI_1718 mutant strains.

  • Gene expression analysis: Measure NT01EI_1718 expression in response to antibiotic exposure.

  • Efflux pump inhibitor studies: If NT01EI_1718 is suspected to function in efflux, test whether inhibitors affect antibiotic susceptibility differently in wild-type versus mutant strains.

  • Membrane permeability assays: Assess whether NT01EI_1718 impacts membrane integrity or permeability to antibiotics.

  • Antibiotic accumulation assays: Measure intracellular antibiotic concentrations in wild-type versus mutant strains.

These approaches would help determine if NT01EI_1718 contributes to the antibiotic resistance phenotypes observed in E. ictaluri isolates.

What structural biology techniques are most suitable for resolving NT01EI_1718 structure?

Membrane proteins present unique challenges for structural determination:

  • X-ray crystallography: Requires high-purity protein and successful crystallization. For membrane proteins like NT01EI_1718, detergent selection is critical.

  • Cryo-electron microscopy (cryo-EM): Increasingly powerful for membrane proteins, especially when incorporated into nanodiscs or other membrane mimetics.

  • Nuclear magnetic resonance (NMR): Useful for smaller membrane proteins or domains, providing dynamic information along with structure.

  • Cross-linking mass spectrometry: Provides distance constraints that can inform computational models.

TechniqueAdvantagesChallenges for NT01EI_1718
X-ray crystallographyHigh resolutionDifficult crystallization of membrane proteins
Cryo-EMNo crystallization requiredMay need larger complexes for optimal resolution
NMRDynamic informationSize limitations (156 aa may be suitable)
Cross-linking MSWorks in native-like environmentsLower resolution structural information

The relatively small size of NT01EI_1718 (156 amino acids) makes it potentially amenable to solution NMR studies if it can be stably reconstituted in membrane mimetics like nanodiscs or detergent micelles.

How should researchers interpret comparative genomic data for NT01EI_1718 across E. ictaluri isolates?

When analyzing genomic data for NT01EI_1718 across isolates:

  • Sequence conservation analysis: Calculate nucleotide and amino acid sequence conservation across isolates. High conservation may indicate essential functions.

  • Phylogenetic analysis: Compare NT01EI_1718 sequences in the context of whole-genome phylogeny to identify patterns of co-evolution with other virulence factors.

  • Geographic and host correlation: Examine whether NT01EI_1718 sequence variants correlate with geographic origin or host species, similar to the genomic epidemiology approach used for Vietnamese isolates .

  • Virulence correlation: Determine if particular NT01EI_1718 variants associate with heightened virulence or specific disease presentations.

Recent genomic analyses of E. ictaluri have revealed clustering of isolates into distinct clades based on virulence gene profiles, particularly related to T3SS genes . Understanding where NT01EI_1718 fits within these genomic patterns would provide context for its potential role in pathogenesis.

What approaches can resolve contradictory experimental results regarding NT01EI_1718 function?

If contradictory results emerge regarding NT01EI_1718 function:

  • Standardize experimental conditions: Ensure consistent bacterial growth conditions, particularly pH and phosphate levels, which are known to affect E. ictaluri virulence gene expression .

  • Genetic background verification: Confirm the genetic background of all strains using whole-genome sequencing to identify any compensatory mutations.

  • Multi-method validation: Employ complementary techniques to verify findings (e.g., both qPCR and Western blotting for expression studies).

  • Strain and isolate diversity: Test hypotheses across multiple E. ictaluri isolates, as strain-specific differences may exist.

  • Careful phenotypic characterization: Use multiple assays to assess complex phenotypes like virulence, rather than relying on a single measurement.

For E. ictaluri specifically, researchers should be mindful that regulatory networks controlling virulence are complex and environmentally responsive. For instance, the pEI2-encoded effector EseI is upregulated under low-pH and low-phosphate conditions but not in an EsrB- or EsrC-dependent manner , illustrating the complexity of virulence regulation.

How might NT01EI_1718 be exploited for developing novel control strategies against E. ictaluri infections?

If NT01EI_1718 proves important for E. ictaluri virulence, potential control strategies include:

  • Subunit vaccine development: If surface-exposed, NT01EI_1718 could be a vaccine antigen candidate.

  • Small molecule inhibitors: If functionally important, compounds targeting NT01EI_1718 might reduce virulence.

  • Diagnostic marker: NT01EI_1718-specific antibodies or PCR assays could improve E. ictaluri detection.

  • Live attenuated vaccines: NT01EI_1718 mutants with attenuated virulence but intact immunogenicity could serve as live vaccine candidates, similar to approaches using T6SS mutants like the evpB deletion strain .

The successful development of a live attenuated E. ictaluri strain with a deletion in the T6SS evpB gene demonstrates the potential of targeting virulence systems for vaccine development . If NT01EI_1718 proves similarly important for virulence but dispensable for immunogenicity, it could represent a valuable target for biocontrol strategies.

How can advanced technologies enhance our understanding of NT01EI_1718 function in host-pathogen interactions?

Emerging technologies offer new avenues for investigating NT01EI_1718:

  • Single-cell RNA-seq: Analyze heterogeneity in host cell responses to wild-type versus NT01EI_1718 mutant infection.

  • CRISPR interference (CRISPRi): Create conditional knockdowns of NT01EI_1718 to study temporal aspects of its function.

  • Proximity labeling proteomics: Identify proteins in close proximity to NT01EI_1718 during infection using BioID or APEX2 approaches.

  • Super-resolution microscopy: Visualize NT01EI_1718 localization with nanometer precision during infection.

  • Nanopore sequencing: Analyze genomic changes in NT01EI_1718 across isolates with long-read technology, as was done for selected E. ictaluri isolates in Vietnam .

These approaches would provide more nuanced insights into NT01EI_1718 function than traditional genetic and biochemical methods alone.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.