Recombinant Eeniella nana Cytochrome c oxidase subunit 2 (COX2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
COX2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Eeniella nana (Yeast) (Brettanomyces nanus)
Target Names
COX2
Target Protein Sequence
MREMMMNNMLNDVPTPWAMYFQDSATPNMEGMMELHNNVLFYLCVMLGFVTYMLYNVMTV YNKSAMAYKYMNHGQFMEMMWTTFPAMMLLMMAFPSFMLLYMCDEVMAPAMTIKAMGLQW YWKYEYSDFMVEKGETMEFESYMIPEDLLEDGQLRMLDVDASVVCPVDTHMRFMVTSADV IHDFCMPSLGIKIDAAPGRLNQTSALMQREGVYYGQCSELCGVMHSSMPIKIEAVPTVDF LAWIDEQ
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (COX2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes cooperate to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives ATP synthesis. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the Cu(A) center in subunit 2 and heme a in subunit 1 to the binuclear center (BNC) in subunit 1, composed of heme a3 and Cu(B). The BNC utilizes four electrons from cytochrome c and four protons from the mitochondrial matrix to reduce molecular oxygen to two water molecules.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Eeniella nana Cytochrome c oxidase subunit 2 (COX2)?

Eeniella nana Cytochrome c oxidase subunit 2 (COX2) is a mitochondrial protein component of the electron transport chain in the yeast species Eeniella nana (also known as Brettanomyces nanus). This protein is encoded by the COX2 gene in the mitochondrial genome, which spans approximately 34.5 kbp in E. nana . The full-length protein consists of 247 amino acids and functions as part of the cytochrome c oxidase complex, which is crucial for cellular respiration. E. nana is phylogenetically related to the Dekkera/Brettanomyces yeasts, with its mtDNA sequence order identical to that of B. custersianus and B. naardenensis .

How is recombinant Eeniella nana COX2 typically expressed?

Recombinant E. nana COX2 is typically expressed in Escherichia coli expression systems. According to available research data, the full-length protein (amino acids 1-247) is commonly expressed with an N-terminal His-tag to facilitate purification . This expression system allows for scalable production of the protein for research purposes. While E. coli is the predominant expression system, the methodology resembles that used for other membrane proteins, which can include denaturation and renaturation steps to obtain functionally active protein, similar to the approaches used for human COX-2 .

What are the recommended storage conditions for recombinant Eeniella nana COX2?

For optimal stability and activity retention, recombinant E. nana COX2 should be stored at -20°C or -80°C upon receipt, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles . When prepared for short-term use, working aliquots can be stored at 4°C for up to one week . The protein is typically supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain protein stability during storage . Adding glycerol to a final concentration of 50% is recommended for long-term storage at -20°C/-80°C .

How should recombinant Eeniella nana COX2 be reconstituted for experimental use?

For optimal reconstitution of lyophilized recombinant E. nana COX2:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended as default)

  • Aliquot for long-term storage at -20°C/-80°C to prevent repeated freeze-thaw cycles

This methodology ensures protein stability while minimizing degradation. For membrane proteins like COX2, additional considerations may include the addition of mild detergents to maintain solubility, though specific detergent requirements for E. nana COX2 are not detailed in the available research.

What purification methods are most effective for recombinant Eeniella nana COX2?

The recombinant E. nana COX2 described in the research is produced with an N-terminal His-tag, suggesting that immobilized metal affinity chromatography (IMAC) is the primary purification method . Based on approaches used for similar proteins, a typical purification protocol would involve:

  • Cell lysis under denaturing conditions (potentially using urea or guanidine hydrochloride)

  • IMAC purification using Ni-NTA resin with appropriate imidazole gradient

  • Refolding through gradual dialysis to remove denaturants

  • Further purification using size-exclusion chromatography

For membrane proteins like COX2, purification strategies often involve denaturation followed by renaturation, as demonstrated in studies with truncated human COX-2 . This approach can yield protein with >90% purity as determined by SDS-PAGE .

What does the mitochondrial DNA sequence reveal about Eeniella nana's evolutionary relationship to other yeasts?

Mitochondrial DNA mapping studies have provided significant insights into the evolutionary relationships between E. nana and other yeast species. Key findings include:

  • The sequence order for the 34.5 kbp mtDNA of E. nana is identical to that of B. custersianus (28.5 kbp) and B. naardenensis (41.7 kbp), suggesting close phylogenetic relationships

  • This sequence homology indicates that E. nana is affiliated with these two Brettanomyces species rather than with Dekkera species

  • In contrast, Dekkera species show different mitochondrial gene arrangements, with D. intermedia and D. bruxellensis having an inversion of the cytochrome b hybridizable region relative to the large ribosomal RNA (LrRNA) sequence

  • B. anomalus (57.7 kbp) exhibits an inversion of the cytochrome oxidase subunit 1 sequence with respect to the LrRNA sequence

These genomic arrangements provide valuable markers for yeast classification and evolutionary studies, indicating that E. nana represents a distinct evolutionary lineage within the Dekkera/Brettanomyces complex.

What experimental challenges are commonly encountered when working with recombinant Eeniella nana COX2?

Researchers working with recombinant E. nana COX2 should anticipate several challenges typical of membrane proteins:

  • Expression efficiency: As a membrane protein, COX2 may form inclusion bodies when expressed in E. coli, requiring optimization of expression conditions including temperature, IPTG concentration, and induction time

  • Protein solubility: Maintaining the solubility of the protein during purification often requires careful selection of detergents or denaturant concentrations

  • Refolding efficiency: If purified under denaturing conditions, refolding to obtain functionally active protein may require extensive optimization

  • Activity assays: Developing reliable assays to confirm that the recombinant protein retains native functionality can be challenging

Similar challenges have been documented for human COX-2 expression in prokaryotic systems, where researchers have employed strategies such as truncating the protein to improve expression while retaining catalytic activity .

How can the activity of recombinant Eeniella nana COX2 be measured and validated?

Validating the functional activity of recombinant E. nana COX2 requires assays that measure its role in the electron transport chain. Based on methodologies used for similar proteins, recommended approaches include:

  • Oxygen consumption assays: Measuring oxygen reduction rates in reconstituted systems

  • Spectroscopic methods: Monitoring changes in absorption spectra during electron transfer

  • Polarographic measurements: Using oxygen electrodes to detect activity

  • Reconstitution experiments: Incorporating the protein into liposomes or nanodiscs to restore native-like membrane environments

The protein's purity can be validated using SDS-PAGE analysis, which should show >90% purity for properly purified samples . Western blotting using anti-His antibodies can confirm the presence of the His-tagged protein.

What experimental controls should be included when studying recombinant Eeniella nana COX2?

Rigorous experimental design for studies involving recombinant E. nana COX2 should include:

  • Negative controls:

    • Empty vector-transformed E. coli processed in parallel

    • Heat-denatured recombinant COX2 to confirm activity loss

    • Inhibitor controls when performing activity assays

  • Positive controls:

    • Well-characterized COX2 from related species

    • Commercial standards where available

  • Validation controls:

    • Mass spectrometry analysis to confirm protein identity

    • Circular dichroism to assess secondary structure integrity

    • Size-exclusion chromatography to verify oligomeric state

These controls help distinguish specific effects from artifacts and ensure reproducibility of experimental findings.

How can site-directed mutagenesis be applied to study structure-function relationships in Eeniella nana COX2?

Site-directed mutagenesis offers a powerful approach for investigating structure-function relationships in E. nana COX2. A systematic experimental strategy might include:

  • Identifying key residues: Analyze sequence alignments with well-characterized COX2 proteins to identify conserved amino acids likely to be functionally important

  • Designing mutations: Create point mutations that:

    • Alter metal-binding sites

    • Modify predicted transmembrane domains

    • Change potential interaction surfaces with other subunits

  • Expression and purification: Express and purify mutant proteins using the same methods as for wild-type

  • Functional characterization: Compare activity of mutants with wild-type using established assays

  • Structural analysis: Employ circular dichroism, thermal stability assays, or other techniques to detect structural changes resulting from mutations

This approach can help map functional domains and understand the molecular basis of COX2 activity in E. nana.

What are the differences in expression efficiency between prokaryotic and eukaryotic systems for Eeniella nana COX2?

While the available research specifically mentions E. coli-based expression of E. nana COX2 , researchers should consider the advantages and limitations of different expression systems:

Expression SystemAdvantagesLimitationsConsiderations for E. nana COX2
E. coli- High yield
- Simple culture conditions
- Economic efficiency
- Well-established protocols
- Lack of eukaryotic post-translational modifications
- Inclusion body formation
- Potential improper folding
- Currently the documented system for expression
- May require refolding from inclusion bodies
Yeast (S. cerevisiae, P. pastoris)- Eukaryotic post-translational modifications
- Better folding of eukaryotic proteins
- High-density cultures
- Lower yields than E. coli
- Longer expression time
- More complex media
- Potentially better for maintaining native structure
- More suitable for functional studies
Insect cells- Complex eukaryotic folding machinery
- Good for membrane proteins
- Expensive
- Technical expertise required
- Longer production timeline
- Could improve functional yield
- Might better preserve native conformation
Wheat germ cell-free- Avoids toxicity issues
- Rapid expression
- Compatible with membrane proteins
- Lower yield
- Cost of reagents
- Similar systems used for human COX2
- Could be explored for E. nana COX2

Each system offers distinct advantages that should be selected based on the specific research objectives, such as structural studies, functional characterization, or interaction analyses.

How does current research on Eeniella nana COX2 contribute to our understanding of yeast mitochondrial function?

Research on E. nana COX2 provides valuable insights into mitochondrial function and evolution across yeast species. The identical sequence order of mtDNA in E. nana, B. custersianus, and B. naardenensis establishes important phylogenetic relationships , while the availability of recombinant protein enables detailed functional studies. Future research directions might include comparative analyses of respiratory efficiency across Dekkera/Brettanomyces species and investigation of COX2's role in adaptations to different environmental conditions.

What emerging technologies might enhance future studies of Eeniella nana COX2?

Several emerging technologies could significantly advance our understanding of E. nana COX2:

  • Cryo-electron microscopy: For high-resolution structural determination without the need for crystallization

  • Nanodiscs and polymer-based membrane mimetics: To study the protein in more native-like membrane environments

  • Single-molecule FRET: To analyze conformational changes during function

  • Integrative structural biology approaches: Combining multiple experimental techniques with computational modeling

  • CRISPR-based genome editing: For in vivo studies of COX2 mutations in yeast models

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.