Recombinant Ehrlichia canis ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can fulfill specific format requirements. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
atpB; Ecaj_0872; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-243
Protein Length
full length protein
Species
Ehrlichia canis (strain Jake)
Target Names
atpB
Target Protein Sequence
MSASPLDQFKILTIFKLPNIAGYNIDFTNASLFMVLSTISVALFCYIGLKKESIIPNGIQ SIVEFIYEFIVSTIESNVGKEGLQYIPLVFTIFMFIATCNLLGILPLGFTATSHIAVTFA ISMVVFVSVTIIGFKHQGIHFLRILLPQGTPGWLAPMMVFIELFAYCARPVSLSIRLAAN MIAGHTIIKVIAGFVVKMNIFLTPLPMIFIIILIGFEIFVAILQAYIFTVLTCVYLSDAV KEH
Uniprot No.

Target Background

Function
ATP synthase subunit a (atpB) is a key component of the proton channel, playing a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of ATP synthase subunit a in Ehrlichia species?

ATP synthase subunit a (atpB) is a hydrophobic membrane protein that forms part of the Fo sector of F-type ATP synthase. In Ehrlichia and related organisms, it functions as a critical component of the proton channel that couples proton translocation to the rotary motion of the enzyme complex. Despite significant sequence divergence from better-studied bacterial models, key structural features remain conserved to maintain functionality.

The F-type ATP synthase consists of two main sectors:

  • F₁ sector: The site of ATP synthesis

  • Fo sector: Couples proton translocation to rotary motion, with subunit a being essential to this process

Like other obligate intracellular bacteria, Ehrlichia species appear to have developed unique adaptations in their ATP synthase components, likely reflecting their specialized lifestyle within host cells. Recent research has identified highly diverged novel subunit compositions in related apicomplexan parasites, suggesting similar diversification may exist in rickettsial organisms like Ehrlichia .

What methods are most effective for expressing recombinant Ehrlichia ATP synthase components?

Expressing functional membrane proteins like ATP synthase subunit a presents significant challenges due to their hydrophobic nature and complex folding requirements. Based on current methodologies, the following approach is recommended:

  • Expression System Selection: E. coli BL21(DE3) or similar strains are commonly used for initial attempts, though expression in insect cells may yield better results for proper folding .

  • Construct Design:

    • Include a solubility-enhancing tag (e.g., SUMO, MBP, or TrxA)

    • Add a purification tag (His6) at the N-terminus

    • Consider expressing only the most conserved domains if full-length protein proves difficult

  • Expression Conditions:

    • Lower induction temperatures (16-18°C)

    • Reduced IPTG concentrations (0.1-0.5 mM)

    • Extended expression times (16-24 hours)

  • Purification Strategy:

    • Membrane solubilization using mild detergents (DDM, LDAO)

    • IMAC purification utilizing the His-tag

    • Size exclusion chromatography for final polishing

When working with Ehrlichia proteins specifically, it's important to optimize codon usage for the expression host and consider the potential toxicity of membrane proteins to bacterial cells .

How do ATP levels in Ehrlichia correlate with bacterial viability outside host cells?

Recent research shows that freshly isolated Ehrlichia can transiently produce ATP, but this capacity diminishes rapidly outside the host environment. Studies with related Ehrlichia species demonstrate a significant correlation between ATP levels and extracellular survival.

In experimental models:

  • Wild-type Ehrlichia maintains higher ATP levels than mutants lacking specific proteins involved in energy metabolism

  • The rapid decline in ATP levels correlates directly with decreased infectivity when bacteria are maintained outside host cells

  • ATP levels drop substantially within 30-60 minutes of extracellular maintenance at 37°C

Ehrlichia TypeInitial ATP LevelATP Level After 30 minATP Level After 60 min
Wild-typeHighModerateLow
ΔripE MutantLowerVery lowMinimal

These findings suggest that ATP production/maintenance is a critical factor in Ehrlichia survival during the transition between host cells and could be an important consideration when working with recombinant proteins from these organisms .

How does sequence divergence in ATP synthase components affect functional studies of recombinant proteins?

The extreme sequence divergence observed in ATP synthase components of intracellular parasites presents significant challenges for recombinant protein production and functional characterization. Research on related organisms has shown that:

  • Despite minimal sequence homology, structural motifs critical for function are conserved

  • Standard homology modeling approaches often fail to identify these components

  • Novel subunits unique to specific taxonomic groups may be present

When working with recombinant Ehrlichia atpB:

  • Computational approaches should focus on structural prediction rather than sequence alignment alone

  • Functional assays must be carefully designed to account for potential differences in optimal conditions

  • Complementation studies in heterologous systems may fail due to incompatibility with other ATP synthase components

Recent studies identified 20 novel subunits of ATP synthase in Toxoplasma gondii through mass spectrometry analysis of partially purified monomeric (~600 kDa) and dimeric (>1 MDa) forms of the enzyme. Similar approaches may be necessary to fully characterize the Ehrlichia ATP synthase complex .

What experimental approaches can determine the relationship between ATP synthase activity and Ehrlichia virulence?

Investigating the relationship between ATP synthase function and bacterial virulence requires integrated approaches:

  • Genetic Manipulation:

    • Generate conditional knockout or knockdown mutants of atpB

    • Create point mutations in conserved functional residues

    • Develop complementation strains with varied expression levels

  • In Vitro Assays:

    • Measure ATP production in isolated bacteria under different conditions

    • Assess bacterial survival in cell-free media

    • Quantify host cell infection rates with mutant vs. wild-type strains

  • In Vivo Models:

    • Compare virulence of ATP synthase mutants in animal models

    • Monitor bacterial loads in tissues

    • Assess clinical manifestations and immune responses

Research with related Ehrlichia proteins has demonstrated that expression levels of certain metabolic components correlate with both ATP maintenance and virulence in mouse models. Wild-type bacteria showed significantly higher virulence compared to mutants, with complemented strains showing intermediate phenotypes, suggesting a direct relationship between energy metabolism and pathogenicity .

How can recombinant ATP synthase components be used for diagnostic development in ehrlichiosis?

Recombinant E. canis ATP synthase components have potential applications in diagnostic test development:

  • Serological Assays:

    • As target antigens in ELISA-based tests

    • For Western blot confirmation assays

    • In multiplex bead-based immunoassays

  • Considerations for Diagnostic Development:

    • Evaluate immunogenicity of different domains

    • Determine cross-reactivity with other Ehrlichia species

    • Assess timing of antibody responses during infection

  • Potential Advantages:

    • Early detection capabilities

    • Differentiation between active and past infections

    • Monitoring treatment efficacy

Studies with experimental E. canis infections demonstrate that certain protein markers appear early in the disease course. While acute phase proteins show abnormal levels by day 3 post-infection, with most peaking around day 18, specific bacterial antigens might allow even earlier detection . Recombinant ATP synthase components could potentially serve as both diagnostic targets and tools to understand the metabolic changes during different infection phases.

What is the relationship between ATP synthase activity and immune evasion in Ehrlichia infections?

Recent research suggests complex relationships between bacterial energy metabolism and immune evasion strategies:

  • ATP-Dependent Immune Evasion Mechanisms:

    • Maintenance of intracellular replication compartments

    • Secretion of effector proteins that modulate host response

    • Regulation of bacterial surface proteins during different infection stages

  • Experimental Approaches to Study This Relationship:

    • Compare host cell responses to wild-type versus ATP synthase-deficient mutants

    • Analyze transcriptional changes in both pathogen and host during infection

    • Examine effects of pharmacological inhibitors of ATP synthase on immune recognition

  • Implications for Research:

    • Designing subunit vaccines that target critical metabolic components

    • Developing therapeutics that disrupt energy metabolism

    • Understanding adaptation of obligate intracellular bacteria to host environments

Studies with related organisms have shown that ATP levels correlate with bacterial virulence in vivo, with higher ATP reserves potentially supporting more effective immune evasion and host cell manipulation . This suggests that ATP synthase components like atpB may be indirectly involved in pathogenicity beyond their primary metabolic functions.

What are the optimal conditions for assessing recombinant ATP synthase activity in vitro?

Testing functional activity of recombinant ATP synthase components requires careful experimental design:

  • Reconstitution Methods:

    • Liposome incorporation using bacterial lipid extracts

    • Nanodiscs for single-molecule studies

    • Detergent-solubilized complexes for initial assessments

  • Activity Measurement Techniques:

    • ATP synthesis assays using luciferin/luciferase

    • Proton translocation measurements with pH-sensitive fluorophores

    • Membrane potential assessments with voltage-sensitive dyes

  • Critical Parameters to Optimize:

    • pH (typically 6.8-7.4)

    • Ionic strength (100-150 mM)

    • Temperature (25-37°C)

    • Lipid composition

    • Proton motive force generation method

Research with cell-free Ehrlichia has demonstrated measurable ATP production that can be quantified using luminescent detection methods. When optimizing such assays for recombinant systems, consideration should be given to the natural environment of the enzyme complex .

How can structural conservation of ATP synthase subunit a be assessed despite sequence divergence?

Given the extreme sequence divergence observed in ATP synthase components of intracellular pathogens, alternative approaches to structural assessment are necessary:

  • Computational Methods:

    • AlphaFold2 and similar AI-based structure prediction tools

    • Analysis of predicted transmembrane regions

    • Conservation mapping of predicted proton-conducting residues

  • Experimental Approaches:

    • Cysteine scanning mutagenesis to map membrane topology

    • Crosslinking studies to identify subunit interactions

    • Limited proteolysis to identify domain boundaries

  • Functional Validation:

    • Complementation studies in heterologous systems

    • Site-directed mutagenesis of predicted key residues

    • Proton translocation assays with reconstituted proteins

Studies with apicomplexan F-type ATP synthases have successfully identified highly diverged subunits based on conserved structural features despite minimal sequence identity. Similar approaches could be applied to Ehrlichia ATP synthase components .

How might ATP synthase components contribute to new therapeutic approaches against ehrlichiosis?

The essentiality and unique features of ATP synthase components make them potential targets for novel therapeutics:

  • Targeting Strategies:

    • Small molecule inhibitors specific to bacterial ATP synthase

    • Peptide inhibitors mimicking critical interaction interfaces

    • Antibody-drug conjugates targeting exposed epitopes

  • Screening Approaches:

    • Structure-based virtual screening

    • Phenotypic assays measuring bacterial ATP production

    • Whole-cell assays for compounds that synergize with existing antibiotics

  • Development Considerations:

    • Selectivity for bacterial over mammalian ATP synthase

    • Penetration into host cells where bacteria reside

    • Resistance potential and mechanisms

The discovery of highly diverged ATP synthase components in related organisms suggests unique structural features that could be exploited for selective targeting. Understanding these differences is critical for rational drug design approaches .

What evolutionary insights can be gained from studying divergent ATP synthase components?

Comparative analysis of ATP synthase components across species provides valuable evolutionary insights:

  • Phylogenetic Considerations:

    • Alveolate clade shows major diversification in ATP synthase composition

    • Apicomplexan and chromerid orthologs show restricted distribution patterns

    • Absence of certain components in closely related species suggests independent evolutionary paths

  • Adaptation Hypotheses:

    • Streamlining of energy production in obligate intracellular lifestyles

    • Development of host-specific modifications for optimal function

    • Balance between functional conservation and sequence divergence

  • Research Approaches:

    • Comparative genomics across related bacterial families

    • Ancestral sequence reconstruction

    • Functional complementation between species

The absence of certain ATP synthase subunits in ciliates while present in apicomplexans, chromerids, and dinoflagellates indicates a major evolutionary divergence within the alveolate clade. Similar patterns may exist within rickettsial bacteria like Ehrlichia .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.