Recombinant Ehrlichia chaffeensis ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Ehrlichia chaffeensis ATP Synthase Subunit a (atpB)

Recombinant Ehrlichia chaffeensis ATP synthase subunit a (atpB) is a bioengineered protein derived from the F₀ sector of the bacterial ATP synthase complex. This enzyme is critical for generating ATP through proton translocation across the inner mitochondrial membrane in eukaryotes or the plasma membrane in prokaryotes. In E. chaffeensis, a tick-borne pathogen causing human monocytic ehrlichiosis, ATP synthase subunit a plays a central role in maintaining cellular energy homeostasis, enabling survival within host cells. The recombinant form is expressed in E. coli with modifications such as N-terminal His tags for purification and stability .

Expression, Purification, and Stability

Recombinant atpB is produced via bacterial expression systems optimized for yield and solubility:

ParameterDetails
Expression HostE. coli BL21(DE3) or similar strains
PurificationAffinity chromatography (His-tag) followed by size-exclusion chromatography
Storage Conditions-20°C (long-term) or 4°C (short-term), lyophilized for extended stability

Source 6 specifies that repeated freeze-thaw cycles should be avoided to preserve activity . The His-tagged construct enhances purification efficiency while maintaining native conformation, as confirmed by SDS-PAGE and Western blotting .

Biochemical Assays

Recombinant atpB may serve as a substrate for studying:

  • Proton Translocation: Assessing subunit a’s role in coupling proton flow to ATP synthesis.

  • Subunit Interactions: Mapping binding interfaces with subunits b, c, and the F₁ complex.

Pathogenicity and Drug Targeting

ATP synthase is a potential therapeutic target. Inhibiting atpB could disrupt E. chaffeensis’ energy production, though clinical relevance remains unexplored.

Challenges and Future Directions

  1. Structural Elucidation: Solving the 3D structure of recombinant atpB would clarify its mechanism.

  2. Functional Validation: Assaying ATP synthesis activity in vitro or reconstituted systems.

  3. Host-Pathogen Interactions: Investigating whether host immune responses target atpB during infection.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing the order. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
atpB; ECH_1086; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-243
Protein Length
full length protein
Species
Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
Target Names
atpB
Target Protein Sequence
MSANPLDQFKISTIFKLPSIGGYNIDFTNASLFMVLSTLIISLFCYIGLRKENILPNSMQ LIIEAIYNFIVSTIESNVGRKGLQYIPLVFTIFTFIATCNLLGVLPLGFTVTSHIAVTFA ISMVVFISVTAIGFKHQGIHFLRILLPKGTPGWLAPMMVFIELFAYCARPVSLSIRLAAN MIAGHTIIKVIAGFVIKMNIFLTPLPMAFIIILIGFEIFVAILQAYIFTVLTCVYLSDAI NEH
Uniprot No.

Target Background

Function
A key component of the proton channel, ATP synthase subunit a (atpB) plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How can recombinant E. chaffeensis ATP synthase subunit a be expressed and purified for functional studies?

For effective expression and purification of functional recombinant E. chaffeensis atpB:

  • Expression System Selection:

    • E. coli is commonly used, with BL21(DE3) or Rosetta strains being particularly suitable for membrane proteins

    • Vectors containing T7 promoters (pET series) with appropriate fusion tags (His, GST, or MBP) optimize expression

  • Expression Protocol:

    • Transform expression vector into selected E. coli strain

    • Culture in LB or 2XYT medium until OD600 reaches 0.6-0.8

    • Induce with 0.1-1.0 mM IPTG at reduced temperature (16-25°C) overnight

    • For membrane proteins, consider specialized media with membrane-supportive components

  • Purification Strategy:

    • Cell lysis using detergent-based buffers (e.g., n-dodecyl β-D-maltoside)

    • Affinity chromatography using immobilized metal affinity chromatography (IMAC)

    • Size exclusion chromatography for further purification

    • Ultrafiltration for concentration and buffer exchange

This approach has been successful for other bacterial ATP synthase components, including those from related intracellular pathogens .

How does E. chaffeensis ATP synthase activity correlate with bacterial infectivity?

Recent studies demonstrate a clear correlation between ATP levels in E. chaffeensis and infectivity. Extracellular E. chaffeensis that maintain higher ATP levels show greater infectivity and resistance to environmental stresses . Specifically:

Bacterial FormRelative ATP LevelInfectivity RetentionTime Post-Host Cell Exit
Wild-typeHigh85-90%30 minutes
ΔripE mutantLow40-45%30 minutes
RipE-overexpressingVery high95-98%30 minutes

Research shows that RipE protein expression directly correlates with ATP levels in extracellular E. chaffeensis, and both factors positively correlate with bacterial virulence in mouse models . This suggests that ATP production capacity is a critical determinant of successful host-to-host transmission and infection establishment.

What methodologies can be employed to measure ATP synthase activity in recombinant E. chaffeensis atpB preparations?

Several complementary approaches can be used to assess ATP synthase activity:

  • Luminescent ATP Detection Assay:

    • Quantify ATP levels using luciferin-luciferase based systems

    • Particularly useful for time-course studies of ATP production/consumption

    • Can detect picomolar ATP concentrations in purified preparations

  • Proton Translocation Measurement:

    • Use pH-sensitive fluorescent probes (e.g., ACMA, pyranine)

    • Monitor proton gradient formation across reconstituted proteoliposomes

    • Correlate proton movement with ATP synthesis activity

  • Oxygen Consumption Analysis:

    • Measure respiratory activity using oxygen electrodes

    • Assess coupling between electron transport chain and ATP synthesis

    • Calculate P/O ratios (ATP produced per oxygen consumed)

  • Reconstitution Studies:

    • Incorporate purified atpB into artificial membrane systems with other ATP synthase components

    • Assess assembly and functionality of the complete F0F1 complex

    • Measure ATP synthesis/hydrolysis in the reconstituted system

For E. chaffeensis specifically, researchers have successfully used the Luminescent ATP Detection Assay Kit to quantify total ATP in host cell-free bacteria under various conditions , making this an established methodology for this organism.

How do mutations in the E. chaffeensis atpB gene affect ATP synthesis and bacterial pathogenesis?

Mutations in atpB can profoundly impact E. chaffeensis bioenergetics and virulence through several mechanisms:

  • Proton Channel Disruption:

    • Mutations in transmembrane domains can alter proton conductance

    • Changes in conserved charged residues (similar to Arg-210 in E. coli) may prevent proper proton translocation

    • This directly impairs ATP generation capacity

  • Assembly Defects:

    • Some mutations prevent proper integration into the F0 complex

    • This results in incomplete ATP synthase assembly and reduced functionality

  • Stability Issues:

    • Certain mutations affect protein stability in the membrane

    • This leads to rapid degradation and loss of ATP synthase function

Virulence consequences include:

  • Reduced extracellular survival time

  • Decreased infectivity in new host cells

  • Attenuated growth within infected cells

  • Diminished ability to modulate host cell responses

While specific atpB mutations haven't been fully characterized in E. chaffeensis, studies of the RipE protein, which correlates with ATP levels, show that genetic complementation can restore ATP levels and partially rescue infectivity , suggesting a potential approach for studying atpB function.

How does the host cell environment influence E. chaffeensis ATP synthase function?

The host cell environment significantly impacts E. chaffeensis ATP synthase function through multiple mechanisms:

  • Metabolite Availability:

    • E. chaffeensis depends on host phospholipid synthesis, as demonstrated by sensitivity to triacsin C (inhibitor of host long-chain acyl-CoA synthetases)

    • The bacterium incorporates host-derived phospholipids into its membranes, which likely affects ATP synthase embedding and function

  • pH Regulation:

    • Intracellular pH affects proton motive force generation

    • Research shows that protein synthesis and DNA synthesis in cell-free E. chaffeensis varies with pH, with optimal activity between pH 6-9

  • Mitochondrial Interference:

    • Some intracellular pathogens target host mitochondria and ADP/ATP carriers

    • While not directly demonstrated for E. chaffeensis, related pathogens can modify host energy metabolism

  • Host Transcriptional Changes:

    • E. chaffeensis effectors can translocate to the host nucleus and modify gene expression

    • Target genes include those associated with ATPase activity , potentially affecting the cellular energy environment

This complex host-pathogen interaction requires consideration of both bacterial and host factors when designing experiments to study ATP synthase function in E. chaffeensis.

What are the optimal conditions for measuring ATP production in cell-free E. chaffeensis preparations?

For accurate measurement of ATP production in cell-free E. chaffeensis:

  • Bacterial Isolation Protocol:

    • Harvest infected host cells at peak infection (typically 72-96 hours post-infection)

    • Lyse host cells using mechanical disruption (Dounce homogenization)

    • Separate bacteria using differential centrifugation

    • Maintain physiological temperature (37°C) and pH (7.4) throughout

  • Buffer Composition:

    • Use buffer containing 137 mM NaCl, 5 mM KCl, 1 mM MgCl2, 20 mM HEPES (pH 7.4)

    • Supplement with 5 mM glucose as energy source

    • Consider adding 4% heat-inactivated fetal bovine serum for extracellular stability

  • Measurement Parameters:

    • Take readings at multiple time points (0, 15, 30, 60 minutes)

    • Use technical triplicates and biological replicates

    • Include appropriate controls (heat-inactivated bacteria, ATP synthase inhibitors)

  • Detection Method:

    • Use luminescence-based ATP detection assays for highest sensitivity

    • Calibrate with known ATP standards in identical buffer conditions

    • Account for background ATP from media components

Based on published protocols, extracellular E. chaffeensis maintains measurable ATP levels for up to 60 minutes post-isolation, with significant decreases occurring after 30 minutes .

How can recombinant E. chaffeensis atpB be used to develop inhibitors for therapeutic applications?

A systematic approach to developing atpB inhibitors includes:

  • Target Validation:

    • Confirm essentiality of atpB through genetic approaches

    • Verify correlation between atpB function and bacterial viability

    • Demonstrate sufficient structural differences from host ATP synthase

  • High-Throughput Screening Protocol:

    • Develop assays using purified recombinant atpB

    • Create reconstituted systems with complete ATP synthase complex

    • Screen compound libraries for inhibition of ATP synthesis

    • Validate hits using secondary assays (bacterial growth inhibition)

  • Structure-Based Drug Design:

    • Generate 3D models of E. chaffeensis atpB based on homology modeling

    • Identify potential binding pockets unique to bacterial protein

    • Design compounds that specifically target these regions

    • Optimize lead compounds using iterative testing

  • Delivery Strategies:

    • Develop methods to target inhibitors to intracellular bacteria

    • Consider carrier systems that can penetrate host and bacterial membranes

    • Test cell-penetrating peptides conjugated to inhibitors

This approach leverages the understanding that ATP synthesis is critical for E. chaffeensis extracellular survival and infection cycle , making atpB an attractive therapeutic target.

What experimental controls are essential when studying interactions between E. chaffeensis atpB and host cell factors?

Critical controls for studying atpB-host interactions include:

  • Specificity Controls:

    • Unrelated bacterial membrane proteins of similar size/structure

    • Mutated versions of atpB with altered binding domains

    • Competitive binding assays with known interactors

  • Technical Controls:

    • Input controls (5-10% of total protein used in pull-downs)

    • Non-specific binding controls (beads/matrix alone)

    • Isotype antibody controls for co-immunoprecipitation

    • Crosslinking efficiency controls

  • Biological Validation:

    • siRNA knockdown of putative host interactors

    • Dose-dependent competition assays

    • Domain mapping experiments

    • Subcellular localization confirmation

  • Functional Assessment:

    • ATP synthase activity measurements in presence/absence of interactors

    • Bacterial survival/growth assays with interactor modulation

    • Host cell response measurements (metabolic, transcriptional)

Example experimental setup for co-immunoprecipitation:

SamplePrimary AntibodyCell TypeTreatmentExpected Result
TestAnti-atpBInfected cellsNoneHost factor present
Control 1IgG isotypeInfected cellsNoneNo host factor
Control 2Anti-atpBUninfected cellsNoneNo host factor
Control 3Anti-atpBInfected cellsCompetitor peptideReduced host factor
Control 4Anti-atpBInfected cellsCrosslinkerEnhanced signal

How does E. chaffeensis atpB compare structurally and functionally to ATP synthase components in other intracellular pathogens?

Comparative analysis reveals important similarities and differences:

  • Structural Comparison:

    • E. chaffeensis atpB (243 amino acids) is similar in size to other α-proteobacterial ATP synthase a-subunits

    • Contains key functional domains including proton channel-forming transmembrane helices

    • Lacks some conserved residues found in free-living bacteria, potentially reflecting adaptation to intracellular lifestyle

  • Functional Distinctions:

    • Unlike mitochondrial ATP synthases, E. chaffeensis atpB likely operates in both synthesis and hydrolysis modes

    • May function at lower efficiency compared to free-living bacteria, reflecting reduced energy demands

    • Shows adaptation to the specific pH and ionic environment of the ehrlichial inclusion

  • Comparison Table:

OrganismATP Synthase a-subunit LengthNotable FeaturesHost Cell Localization
E. chaffeensis243 aaAdapts to inclusion environmentCytoplasmic inclusion
Chlamydia trachomatis249 aaActive in elementary bodiesInclusion vacuole
Rickettsia prowazekii240 aaSimilar to mitochondrialCytoplasm (free)
Anaplasma phagocytophilum238 aaClose homology to E. chaffeensisCytoplasmic inclusion
  • Evolutionary Considerations:

    • Phylogenetic analysis suggests evolutionary adaptations specific to the intracellular lifestyle

    • May represent an intermediate form between free-living bacterial and mitochondrial ATP synthases

These comparisons provide valuable context for interpreting E. chaffeensis atpB function and for developing targeted therapeutics.

What technologies are emerging for studying ATP dynamics in obligate intracellular bacteria like E. chaffeensis?

Cutting-edge technologies for studying ATP dynamics include:

  • Genetically Encoded ATP Sensors:

    • FRET-based sensors (ATeam, QUEEN)

    • Can be expressed in bacteria to monitor intracellular ATP in real-time

    • Challenge: introducing genetic constructs into obligate intracellular pathogens

  • Single-Cell Analysis Methods:

    • Microfluidic platforms for isolating individual bacteria

    • Patch-clamp techniques adapted for bacterial membranes

    • Single-cell mass spectrometry for metabolite analysis

  • Advanced Imaging Technologies:

    • Super-resolution microscopy to visualize ATP synthase complexes

    • Correlative light and electron microscopy (CLEM)

    • Label-free imaging methods (Raman microscopy, mass spectrometry imaging)

  • Cell-Free Cultivation Systems:

    • Development of axenic media supporting E. chaffeensis metabolism

    • Has shown promise for studying DNA and protein synthesis

    • Potential platform for directly manipulating energy metabolism

  • In situ Cryo-Electron Tomography:

    • Visualization of ATP synthase in native cellular environment

    • Potential to reveal structural adaptations in intracellular context

    • Requires specialized sample preparation for intracellular bacteria

Implementation challenges include the need for genetic manipulation systems in E. chaffeensis and adaptation of technologies to the small size and intracellular lifestyle of the pathogen.

How might targeting E. chaffeensis ATP synthase complement other therapeutic approaches for ehrlichiosis?

A comprehensive therapeutic strategy incorporating ATP synthase inhibition could include:

  • Combination Therapy Approaches:

    • ATP synthase inhibitors + antibiotic (doxycycline) synergy

    • Predicted enhanced efficacy due to targeting different bacterial systems

    • Potential for dose reduction of individual agents, minimizing side effects

  • Multi-Stage Targeting Strategy:

    • ATP synthase inhibition primarily affects extracellular bacteria and early infection

    • Complements therapies targeting intracellular replication phases

    • Creates a comprehensive approach covering all phases of bacterial life cycle

  • Host-Directed Therapy Integration:

    • ATP synthase inhibitors directly target bacterial energy production

    • Can be combined with modulators of host immune response

    • Potential combination with host metabolic modifiers that further stress bacterial energy systems

  • Novel Delivery Platforms:

    • Nanoparticle-based delivery of ATP synthase inhibitors

    • Cell-penetrating peptide conjugates for improved intracellular targeting

    • Sustained-release formulations for prolonged therapeutic effect

  • Expected Therapeutic Advantages:

    • Reduced resistance development through multi-target approach

    • Enhanced clearance rates compared to single-agent therapy

    • Potential for shorter treatment duration

This integrated approach leverages the understanding that ATP production is critical for E. chaffeensis extracellular survival and initial infection establishment , creating a vulnerable point in the bacterial life cycle.

What are the most promising directions for future research on E. chaffeensis ATP synthase?

Priority research areas include:

  • Structural Biology:

    • Determine high-resolution structure of E. chaffeensis ATP synthase complex

    • Identify unique structural features that could be exploited for inhibitor design

    • Characterize the interaction of ATP synthase with other bacterial proteins

  • Genetic Manipulation:

    • Develop more efficient transformation systems for E. chaffeensis

    • Create conditional mutants of ATP synthase components

    • Apply CRISPR interference technologies to study ATP synthase gene expression

  • Host-Pathogen Interactions:

    • Elucidate how E. chaffeensis modulates host cell energy production

    • Characterize specific interactions between bacterial ATP synthase and host factors

    • Investigate how bacterial ATP production influences host cell metabolic pathways

  • Therapeutic Applications:

    • Develop high-throughput screening platforms for ATP synthase inhibitors

    • Identify natural products with activity against E. chaffeensis ATP synthase

    • Explore peptide inhibitors targeting unique regions of ATP synthase components

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.