Recombinant Elaphodus cephalophus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondrial Complex I

MT-ND4L is essential for complex I assembly and electron transfer from NADH to ubiquinone. In E. cephalophus, its role aligns with:

  • Electron Transport: Facilitates proton translocation across the inner mitochondrial membrane, driving ATP synthesis .

  • Complex I Structure: Forms part of the membrane-embedded subunit, interacting with other subunits to stabilize the enzyme’s active site .

Mutations in MT-ND4L disrupt complex I activity, leading to ATP deficiency and tissue-specific pathologies like optic nerve degeneration .

Phylogenetic Studies

The MT-ND4L gene has been pivotal in resolving evolutionary relationships within Cervidae. Phylogenetic analyses using mitochondrial genomes (e.g., E. cephalophus) reveal:

  • Sister Relationship: Elaphodus shares a closer phylogenetic affinity with Muntiacus (muntjacs) than with other cervids .

  • Mitochondrial Genome: The E. cephalophus mitogenome (16,196 bp) includes 13 protein-coding genes, with MT-ND4L contributing to species-specific gene arrangements .

Diagnostics and Antibody Detection

Recombinant MT-ND4L is used in ELISA kits to detect antibodies or quantify protein levels in biological samples . Key advantages include:

  • High Specificity: His-tagged protein enables efficient purification and reproducibility in assays.

  • Cross-Species Utility: Due to conserved regions in complex I subunits, the protein may serve as a reference for studying mitochondrial diseases in diverse species .

Research Challenges and Future Directions

  1. Structural Insights: Limited 3D structures of MT-ND4L hinder mechanistic studies; AlphaFold predictions could bridge this gap .

  2. Disease Modeling: Recombinant MT-ND4L variants (e.g., Val65Ala) may replicate Leber hereditary optic neuropathy phenotypes in vitro .

  3. Conservation Genetics: The E. cephalophus mitogenome provides a framework for tracking genetic diversity in endangered deer populations .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Elaphodus cephalophus (Tufted deer)
Target Names
Target Protein Sequence
MSLVYMNIMTAFTVSLTGLLMYRSHLMSSLLCLEGMMLALFVMATLTILNSHFTLASMMP IILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC
Uniprot No.

Target Background

Function
This protein is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the function of MT-ND4L in mitochondrial respiration?

MT-ND4L (mitochondrially encoded NADH dehydrogenase 4L) is an essential protein subunit of Complex I (NADH:ubiquinone oxidoreductase) in the mitochondrial respiratory chain. It participates in the first step of the electron transport process, transferring electrons from NADH to ubiquinone. This protein is embedded in the inner mitochondrial membrane and contributes to generating the electrochemical gradient that drives ATP synthesis during oxidative phosphorylation . In Elaphodus cephalophus, as in other mammals, MT-ND4L works in concert with other ND subunits to maintain proper Complex I activity, which is crucial for cellular energy production.

How does the structure of Elaphodus cephalophus MT-ND4L compare to other species?

While the search results don't provide specific structural information about Elaphodus cephalophus MT-ND4L, mitochondrial proteins are generally highly conserved across mammalian species due to their essential functions. MT-ND4L typically contains transmembrane domains that anchor it within the inner mitochondrial membrane . Comparative analysis with other Cetartiodactyla species (the order to which tufted deer belongs) would likely show high sequence conservation, particularly in functional domains . The protein is encoded by the mitochondrial genome and often exhibits specific adaptations that may reflect evolutionary pressures related to the metabolic requirements of different species.

What conservation patterns exist in MT-ND4L across Cetartiodactyla?

MT-ND4L sequences show evolutionary patterns consistent with their essential function in cellular respiration. Within Cetartiodactyla (the mammalian order including deer, cattle, camels, and cetaceans), the gene shows significant conservation, particularly in functionally critical regions . Analyses of complete mitochondrial genomes across this order have revealed that MT-ND4L is subject to purifying selection pressure due to its vital role in energy metabolism. Specific amino acid residues involved in electron transport and protein-protein interactions within Complex I show the highest degree of conservation. Phylogenetic analyses of mitochondrial genomes, including MT-ND4L, have been valuable for understanding the evolutionary relationships among Cetartiodactyla species .

What are the optimal methods for expressing recombinant Elaphodus cephalophus MT-ND4L?

Expressing functional recombinant mitochondrial proteins presents unique challenges due to their hydrophobic nature and complex assembly requirements. For Elaphodus cephalophus MT-ND4L, researchers should consider the following methodological approach:

  • Expression System Selection: Bacterial systems (E. coli) with specialized strains designed for membrane proteins offer a starting point, but yeast systems (P. pastoris) or insect cell lines may provide better folding for mammalian mitochondrial proteins.

  • Vector Design: Incorporate purification tags (His-tag or FLAG-tag) at the N-terminus rather than C-terminus to minimize interference with membrane integration. Include codon optimization for the expression system.

  • Solubilization Strategy: Use mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin for extraction, as these preserve protein-protein interactions required for proper folding.

  • Verification Methods: Employ Western blotting with antibodies against conserved epitopes of MT-ND4L or against the purification tag, followed by mass spectrometry verification.

When designing experiments, researchers should note that co-expression with other Complex I subunits may improve proper folding and stability of recombinant MT-ND4L.

How can researchers reliably assess the functional activity of recombinant MT-ND4L?

Functional assessment of recombinant MT-ND4L requires both isolated protein analysis and integration studies:

  • NADH:Ubiquinone Oxidoreductase Activity Assay: Measure electron transfer from NADH to ubiquinone using spectrophotometric methods that track NADH oxidation at 340 nm. Compare activity rates between preparations containing recombinant MT-ND4L and control preparations.

  • Membrane Potential Measurements: Use fluorescent dyes like JC-1 or TMRM to assess whether recombinant MT-ND4L properly contributes to generating membrane potential when incorporated into artificial liposomes or isolated mitochondria.

  • Reconstitution Experiments: Integrate the recombinant protein into Complex I-deficient mitochondrial preparations (from cell lines with MT-ND4L mutations or deletions) and measure restoration of Complex I activity.

  • Protein-Protein Interaction Analysis: Use techniques like co-immunoprecipitation or crosslinking studies to verify proper interaction of recombinant MT-ND4L with other Complex I subunits, particularly ND4, with which it typically forms a functional module .

These approaches collectively provide comprehensive functional assessment beyond simple expression verification.

What purification challenges are specific to MT-ND4L and how can they be overcome?

Purifying MT-ND4L presents several specific challenges due to its hydrophobic nature and relatively small size:

  • Solubility Issues: MT-ND4L contains multiple transmembrane domains that make it prone to aggregation. Solution: Use a gradient of increasing detergent concentrations during extraction, starting with 0.5% digitonin and gradually shifting to 1-2% DDM.

  • Co-purification Contaminants: MT-ND4L often maintains strong interactions with other Complex I subunits. Solution: Implement a two-step purification strategy combining affinity chromatography (using the purification tag) followed by size exclusion chromatography.

  • Stability Concerns: Isolated MT-ND4L tends to denature rapidly. Solution: Maintain samples at 4°C throughout purification, include 10-15% glycerol in all buffers, and consider adding specific phospholipids (cardiolipin at 0.1-0.2 mg/ml) to stabilize protein structure.

  • Low Yield: Expression levels of functional protein are typically low. Solution: Scale up culture volumes and optimize induction conditions (reduced temperature of 16-18°C for expression over extended periods of 16-24 hours).

Documentation of purification efficiency at each step using Western blot analysis is essential for protocol optimization.

How can recombinant MT-ND4L be used to study mitochondrial disorders?

Recombinant Elaphodus cephalophus MT-ND4L provides a valuable research tool for studying mitochondrial disorders through several approaches:

  • Mutation Modeling: Introducing known pathogenic mutations (such as those found in Leber hereditary optic neuropathy cases like the Val65Ala variant mentioned in humans ) into recombinant MT-ND4L allows researchers to study their biochemical effects on protein function in a controlled system.

  • Rescue Experiments: In cell lines derived from patients with MT-ND4L mutations, delivery of functional recombinant protein (using mitochondrial targeting sequences) can help determine if phenotypic rescue is possible and inform gene therapy approaches.

  • Structural Studies: Purified recombinant MT-ND4L can be used for structural analyses through techniques like cryo-electron microscopy, particularly in complex with other mitochondrial proteins, to understand how mutations disrupt protein-protein interactions.

  • Drug Screening Platforms: Establishing assays with recombinant MT-ND4L allows for screening compounds that might stabilize mutant proteins or enhance residual Complex I activity, potentially identifying therapeutic candidates for mitochondrial disorders.

These applications contribute to both basic understanding of mitochondrial disease mechanisms and translational research for therapeutic development.

What approaches can be used to study the evolutionary significance of MT-ND4L variations across Cetartiodactyla species?

Studying evolutionary patterns in MT-ND4L across Cetartiodactyla species requires integrated bioinformatic and experimental approaches:

  • Comparative Sequence Analysis: Align MT-ND4L sequences from multiple Cetartiodactyla species, including Elaphodus cephalophus, to identify conserved and variable regions. Calculate dN/dS ratios to detect sites under positive or purifying selection .

  • Ancestral Sequence Reconstruction: Use Bayesian or maximum likelihood methods to infer ancestral MT-ND4L sequences at key nodes in the Cetartiodactyla phylogenetic tree, then express these reconstructed proteins to compare their functional properties with extant variants.

  • Ecological Correlation Studies: Analyze whether specific MT-ND4L variations correlate with ecological adaptations (high-altitude living, cold adaptation, diving behavior in cetaceans) across the order.

  • Functional Comparisons: Express recombinant MT-ND4L from species occupying different ecological niches (comparing Elaphodus cephalophus with aquatic cetaceans, for example) and measure biochemical parameters like oxygen affinity, NADH binding efficiency, and thermal stability.

These approaches can reveal how natural selection has shaped MT-ND4L function across evolutionary time in response to different metabolic demands .

How can researchers investigate interactions between MT-ND4L and MT-ND4 in Complex I assembly?

Investigating the interaction between MT-ND4L and MT-ND4 is crucial for understanding Complex I assembly and function:

  • Co-expression Systems: Design dual expression vectors that produce both MT-ND4L and MT-ND4 with different affinity tags to enable purification of the intact complex. Monitor co-expression using fluorescent fusion proteins to track cellular localization.

  • Cross-linking Mass Spectrometry: Apply chemical cross-linkers to stabilize protein-protein interactions, followed by mass spectrometry analysis to identify specific residues at the interface between MT-ND4L and MT-ND4 .

  • Mutagenesis Studies: Create systematic mutations in potential interaction domains of both proteins and assess their impact on complex formation and function. This approach can identify critical residues mediating the interaction.

  • Blue Native PAGE Analysis: Use non-denaturing electrophoresis to separate intact complexes and subcomplexes, allowing visualization of assembly intermediates and assessment of how mutations affect complex formation.

  • Computational Modeling: Employ molecular dynamics simulations based on available structural data to predict interaction surfaces and the energetics of binding between the two proteins.

These methodologies collectively provide insights into how these two mitochondrially encoded proteins interact during the assembly and functioning of Complex I.

What are the most common artifacts in MT-ND4L functional assays and how can they be controlled?

Several artifacts commonly affect MT-ND4L functional assays and require specific control measures:

  • Non-specific NADH Oxidation:

    • Problem: Background NADH oxidation unrelated to MT-ND4L activity

    • Solution: Include rotenone (Complex I-specific inhibitor) controls to determine specific vs. non-specific activity; subtract rotenone-insensitive activity from total measurements

  • Protein Aggregation Effects:

    • Problem: Misfolded or aggregated MT-ND4L giving false negative results

    • Solution: Verify protein solubility through dynamic light scattering before assays; optimize detergent conditions; use thermal shift assays to confirm proper folding

  • Artificial Electron Acceptors:

    • Problem: Artificial electron acceptors may interact with MT-ND4L differently than natural ubiquinone

    • Solution: Compare results using different acceptors (decylubiquinone, coenzyme Q1, Q10); validate with ubiquinone whenever possible

  • pH and Temperature Sensitivity:

    • Problem: Activity fluctuations due to suboptimal pH or temperature conditions

    • Solution: Establish activity profiles across pH range (6.5-8.0) and temperatures (25-40°C); maintain strict consistency in assay conditions

For all functional assays, researchers should implement parallel positive controls using well-characterized Complex I preparations to normalize experimental results.

What methods are available for analyzing MT-ND4L mutations in Elaphodus cephalophus populations?

Analyzing MT-ND4L mutations in Elaphodus cephalophus populations requires specialized approaches for mitochondrial DNA:

  • Field Sampling Strategy:

    • Non-invasive sampling using shed hair, fecal samples, or environmental DNA

    • Proper preservation using silica gel desiccation or ethanol fixation to prevent DNA degradation

    • GPS documentation of sampling locations for geographic correlation

  • DNA Extraction and Amplification:

    • Modified phenol-chloroform extraction protocols optimized for mitochondrial DNA

    • PCR amplification using conserved Cetartiodactyla MT-ND4L primers with specificity for Elaphodus

    • Long-range PCR approaches that can amplify the entire mitochondrial genome

  • Sequencing and Variant Detection:

    • Direct Sanger sequencing for individual samples

    • Next-generation sequencing for population-level analysis

    • Bioinformatic pipelines specific for mitochondrial heteroplasmy detection

  • Population Genetics Analysis:

    • Haplotype network construction to visualize relationships

    • Tests for selection (Tajima's D, Fu's Fs) to identify non-neutral evolution

    • Geographic information system integration to map variant distribution

This methodological framework allows researchers to assess both the prevalence and functional significance of MT-ND4L variations in wild populations of Elaphodus cephalophus.

How should researchers interpret differences in electron transport activity between wild-type and mutant MT-ND4L variants?

Interpreting electron transport activity differences requires systematic analysis and careful controls:

  • Quantitative Assessment Framework:

ParameterWild-Type MT-ND4LMutant MT-ND4LInterpretation Guidelines
NADH:ubiquinone oxidoreductase activity (nmol/min/mg)Baseline value% of wild-type<50%: Severe defect
50-70%: Moderate defect
70-90%: Mild defect
Oxygen consumption rate (pmol O₂/min/cells)Baseline value% of wild-typeCompare with CI inhibitor (rotenone) sensitivity
ROS production (relative fluorescence units)Baseline value% change from wild-typeIncreases often indicate electron leakage
Membrane potential (TMRM fluorescence)Baseline value% of wild-typeCorrelate with ATP synthesis capacity
  • Contextual Analysis Principles:

    • Always normalize to a control protein subunit's expression level

    • Consider compensatory activation of alternate respiratory pathways

    • Evaluate temperature sensitivity of activity (measurement at 30°C vs. 37°C vs. 40°C)

    • Assess activity across multiple substrate concentrations (NADH titration curve)

  • Interpretation Challenges:

    • Distinguish between effects on enzyme kinetics (Km vs. Vmax changes)

    • Consider assembly defects vs. catalytic defects by analyzing Complex I formation

    • Evaluate secondary effects on other respiratory complexes

When interpreting results, researchers should consider the evolutionary context of the specific mutation and whether it occurs in regions conserved across Cetartiodactyla or represents a species-specific adaptation in Elaphodus cephalophus .

What approaches are recommended for comparing MT-ND4L function across different Cetartiodactyla species?

Cross-species functional comparison of MT-ND4L requires standardized approaches:

  • Standardized Expression and Purification:

    • Express all species variants in the identical system (preferably mammalian)

    • Use identical tags and purification protocols

    • Verify equal protein purity and concentration before comparative analyses

  • Functional Assays Under Varied Conditions:

    • Conduct electron transfer assays across temperature gradients (4-42°C)

    • Test pH sensitivity spanning physiologically relevant ranges (pH 6.8-8.0)

    • Measure activity with varying substrate concentrations to derive kinetic parameters

  • Structural Stability Comparisons:

    • Thermal denaturation profiles using circular dichroism spectroscopy

    • Detergent and chemical denaturant resistance assays

    • Proteolytic susceptibility using controlled protease digestion

  • Phylogenetic Framework Integration:

    • Map functional differences onto a robust phylogeny of Cetartiodactyla

    • Correlate functional adaptations with ecological transitions

    • Calculate ancestral character states for functional parameters

This comprehensive approach allows researchers to distinguish between species-specific adaptations and conserved functional requirements, providing insights into how evolutionary pressures have shaped MT-ND4L function across related species.

What emerging technologies could advance our understanding of MT-ND4L structure and function?

Several cutting-edge technologies show promise for advancing MT-ND4L research:

  • Cryo-Electron Microscopy Advances:

    • Sub-2Å resolution capabilities now allow visualization of hydrogen bonds and water molecules within membrane proteins

    • Time-resolved cryo-EM could capture conformational changes during electron transport

    • Application to MT-ND4L would reveal precise structural interactions with other Complex I components

  • Single-Molecule Techniques:

    • FRET-based approaches can measure conformational dynamics during catalysis

    • Optical tweezers combined with electrical recordings could correlate mechanical changes with proton pumping

    • These techniques would provide unprecedented insights into how MT-ND4L contributes to energy coupling

  • In-Cell Structural Biology:

    • NMR methods for membrane protein structure determination in native environments

    • Mass spectrometry techniques that can analyze intact membrane protein complexes

    • These approaches would reveal how cellular factors influence MT-ND4L function

  • Computational Approaches:

    • AI-powered protein structure prediction specifically optimized for mitochondrial membrane proteins

    • Molecular dynamics simulations spanning microsecond timescales to capture complete catalytic cycles

    • These computational tools would complement experimental findings and generate testable hypotheses

These technologies will allow researchers to address longstanding questions about how MT-ND4L contributes to the proton-pumping mechanism of Complex I.

How might understanding species-specific variations in MT-ND4L contribute to conservation efforts for Elaphodus cephalophus?

Understanding MT-ND4L variations has significant implications for tufted deer conservation:

  • Genetic Diversity Assessment:

    • MT-ND4L variations can serve as markers for population genetic diversity

    • Mitochondrial haplotype mapping can identify genetically distinct populations requiring conservation priority

    • Historical population size and bottleneck events can be inferred from mitochondrial genetic diversity

  • Adaptation Potential Analysis:

    • Functional variants may reflect local adaptations to specific environmental conditions

    • Understanding metabolic adaptations could inform habitat protection priorities

    • Correlation between specific variants and fitness metrics could identify vulnerable populations

  • Climate Change Vulnerability:

    • MT-ND4L function at different temperatures may predict population resilience to warming climates

    • Metabolic efficiency differences between variants could influence thermal tolerance

    • Species with limited MT-ND4L genetic diversity may have reduced adaptive potential

  • Conservation Management Applications:

    • Translocation programs could utilize MT-ND4L data to match source populations to appropriate habitats

    • Captive breeding programs could maintain critical genetic diversity in MT-ND4L

    • Monitoring programs could track frequencies of functional variants over time

These applications demonstrate how basic mitochondrial research translates into practical conservation tools for protecting endangered species like Elaphodus cephalophus.

What are the recommended controls when studying the impact of environmental stressors on MT-ND4L function?

When investigating environmental stress effects on MT-ND4L function, researchers should implement these essential controls:

  • General Experimental Controls:

    • Vehicle-only treatments controlling for solvent effects in chemical exposures

    • Time-matched controls for each experimental timepoint to account for temporal variations

    • Randomized treatment allocation with blinded analysis to prevent bias

    • Technical replicates (minimum n=3) and biological replicates (minimum n=5)

  • MT-ND4L-Specific Controls:

    • Parallel assessment of nuclear-encoded Complex I subunits to distinguish selective mitochondrial effects

    • Measurement of mtDNA copy number alongside MT-ND4L expression

    • Analysis of multiple control mitochondrial genes (MT-CO1, MT-CYB) to identify MT-ND4L-specific effects

    • Inclusion of known MT-ND4L inhibitor controls (rotenone, piericidin A) at standardized concentrations

  • Stress-Response Validation:

    • Verification of stress induction using established biomarkers (HSP70 for heat stress, HIF1α for hypoxia)

    • Dose-response curves to establish threshold effects

    • Recovery experiments to distinguish adaptive from toxic responses

    • Measurement of general mitochondrial parameters (membrane potential, ROS) alongside MT-ND4L-specific measures

These controls ensure that observed effects can be specifically attributed to MT-ND4L responses rather than general cellular stress responses or experimental artifacts.

How can researchers effectively model MT-ND4L-associated diseases using recombinant proteins?

Modeling MT-ND4L-associated diseases requires sophisticated approaches bridging biochemistry and disease phenotypes:

  • Disease-Associated Mutation Selection:

    • Prioritize mutations with clear clinical phenotypes (e.g., the Val65Ala mutation associated with Leber hereditary optic neuropathy)

    • Include both pathogenic mutations and benign polymorphisms as controls

    • Consider species-specific variations that might modify disease expression

  • Comprehensive Functional Analysis:

    • Enzymatic activity measurements under conditions mimicking physiological stress

    • Protein stability assessments using thermal shift assays and limited proteolysis

    • Interaction studies with other Complex I subunits using co-immunoprecipitation

    • ROS production quantification using specific fluorescent probes

  • Cellular Model Integration:

    • Introduce recombinant MT-ND4L (wild-type and mutant) into cybrids lacking endogenous protein

    • Assess tissue-specific effects using differentiated cell types (neurons for LHON models)

    • Measure cellular phenotypes (ATP production, apoptosis susceptibility, calcium handling)

    • Verify mitochondrial localization and incorporation into Complex I

  • Therapeutic Screening Platform Development:

    • Establish scalable assays measuring key defects (electron transport, ROS) amenable to high-throughput screening

    • Include positive control compounds known to modify mitochondrial function

    • Implement dose-response testing with counter-screens for toxicity

    • Validate hits in cellular models expressing the recombinant protein

This integrated approach connects biochemical defects in recombinant MT-ND4L to cellular disease phenotypes, creating a platform for mechanistic understanding and therapeutic development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.