Elapsoidea semiannulata, commonly known as the Angolan garter snake, belongs to the Elapidae family, which includes venomous snakes such as cobras, mambas, and coral snakes. This species has been included in comprehensive phylogenetic studies of elapid snakes, particularly those analyzing relationships between African, American, Asian, and marine/Australo-Melanesian elapid groups .
Cytochrome b is encoded by the MT-CYB gene located in the mitochondrial genome. In elapid snakes, including Elapsoidea semiannulata, the cytochrome b gene varies in length from 1101 to 1122 base pairs . The gene has been extensively sequenced for phylogenetic studies, with the Elapsoidea semiannulata sequence previously deposited in GenBank (accession number U80618) . This gene shows variations in length primarily due to deletions and/or insertions at the 3' end rather than internal modifications .
The amino acid sequence of Elapsoidea semiannulata Cytochrome b, as documented in the UniProt database (accession number P87416), is as follows :
YINYKNSSNQHTLLMSNLLPVGSNISTWWNFGSMLLICLMLQTLTGFFLAIHYTANINLAFSSVVHITRDVPYGWTMQNLHAISASLFFICIYIHIARGLYYGLYMNKEVWLSGVTLLFTLMATAFFGYVLPWGQMSFWAATVITSLLTAIPYLGTMLTTWLWGGFSXNDPLTTRFFALHFILPFIIISLSSAHIMLLHAEGSNNPLGTNSDID
This sequence represents the expression region 1-214 of the full-length protein and contains structural elements typical of cytochrome b proteins, with regions that anchor it to the inner mitochondrial membrane .
Cytochrome b functions as a critical component of the respiratory chain complex III, also known as the cytochrome bc1 complex or ubiquinol-cytochrome c reductase . This complex plays an essential role in the electron transport chain that drives cellular energy production through oxidative phosphorylation. The protein has several alternative names reflecting its function, including:
Complex III subunit 3
Complex III subunit III
Cytochrome b-c1 complex subunit 3
Ubiquinol-cytochrome-c reductase complex cytochrome b subunit
The cytochrome b gene sequence from Elapsoidea semiannulata has been instrumental in resolving phylogenetic relationships among elapid snakes . In comprehensive studies of snake evolution, this sequence has been analyzed alongside those from other elapid genera to determine evolutionary relationships between African, American, Asian, and marine/Australo-Melanesian elapid lineages .
Research methodologies typically involve sequencing the entire cytochrome b gene, with analysis performed using maximum-parsimony and maximum-likelihood methods . These approaches have yielded similar phylogenetic trees, contributing significantly to our understanding of elapid snake evolution.
Cytochrome b serves as a crucial component in the mitochondrial respiratory chain, and studies of this protein from various species provide insights into the function and biogenesis of respiratory complexes . Research involving MT-CYB has demonstrated that:
Mutations in this gene can cause complex III deficiency
The genetic mtDNA background can significantly influence the expression of primary pathogenic mutations
MT-CYB plays a critical role in the assembly and stability of respiratory chain complexes
Table 2: Comparison of Cytochrome b Characteristics Across Selected Species
| Species | Gene Length (bp) | Termination Signal | Key Research Applications |
|---|---|---|---|
| Elapsoidea semiannulata | Variable (likely ~1116) | Data not available | Phylogenetic analysis of elapid snakes |
| Acanthophis antarcticus | 1116 | T | Comparative studies of venomous snakes |
| Aspidelaps scutatus | 1116 | T | Elapid evolution research |
| Human (Homo sapiens) | ~1140 | Not specified | Mitochondrial disorders, complex III deficiency |
Studies of MT-CYB have significant relevance to human health, as mutations in this gene constitute a major cause of complex III deficiency in humans . Clinical manifestations of such deficiencies can include lactic acidosis, seizures, developmental delays, and behavioral abnormalities .
The study of recombinant cytochrome b proteins from different species, including Elapsoidea semiannulata, can contribute to our understanding of:
The structure-function relationship in respiratory chain complexes
The evolutionary conservation of critical protein domains
The mechanisms of mitochondrial complex assembly and stability
Research has demonstrated that the mitochondrial genetic background hosting a primary pathogenic mutation can significantly influence the clinical expression of mitochondrial disorders . This finding highlights the importance of considering the entire mitochondrial genome in the assessment of pathogenic mutations.
Experimental studies using transmitochondrial cybrids (cells with identical nuclear genetic material but different mitochondrial DNA) have confirmed the direct functional effects of the mitochondrial genetic background on the biogenesis and function of respiratory chain complexes .
Further biochemical characterization of recombinant Elapsoidea semiannulata Cytochrome b could elucidate species-specific aspects of electron transport and complex III function, potentially revealing adaptations unique to elapid snakes.
Continued integration of cytochrome b sequence data with other genetic markers will further refine our understanding of snake evolution and the relationships among elapid species. Such studies may provide insights into the biogeography and adaptive radiation of these venomous snakes.
Elapsoidea semiannulata Cytochrome b (MT-CYB) is a mitochondrial gene from the African elapid snake Elapsoidea semiannulata, commonly known as the half-banded snake. This gene encodes a critical protein involved in the electron transport chain within mitochondria. The MT-CYB gene has become a cornerstone marker in phylogenetic studies of snakes, particularly in resolving relationships among elapid snakes (venomous snakes including cobras, mambas, and coral snakes) .
The significance of this gene lies in its evolutionary rate, which makes it particularly suitable for resolving relationships at various taxonomic levels. In molecular phylogenetic studies, such as those conducted by Slowinski and Keogh, the entire cytochrome b gene was sequenced for numerous elapid species including Elapsoidea semiannulata to determine their evolutionary relationships . These analyses have helped resolve previously contested relationships, particularly among African, American, and Asian elapid lineages.
For successful amplification of the Cytochrome b gene from Elapsoidea semiannulata and other snake species, researchers typically employ specific primer sets and optimized PCR conditions. Based on established protocols, the following primers and conditions are recommended:
Standard Primer Set for CYB Amplification:
| Gene | Primer Direction | Primer Sequence |
|---|---|---|
| CYB | Forward | 5'-TATCCGCCATCCCATACATT-3' |
| CYB | Reverse | 5'-GGTGATTCCTAGGGGGTTGT-3' |
Optimized PCR Conditions:
Initial denaturation: 5 minutes at 95°C
Denaturation: 2 minutes at 94°C
Annealing: 1 minute at 61°C
Extension: 2 minutes at 72°C
Final extension: 10 minutes at 72°C
Hold: 4°C
For each PCR reaction, a standard mixture includes 25 μl of EcoTaq 2× PCR Master Mix, 2 μl of forward primer (10 μM), 2 μl of reverse primer (10 μM), 10 pg-500 μg template DNA, and ddH₂O to the required volume . The expected amplicon size for the CYB gene is approximately 675 bp, which can be visualized on a 2% agarose gel stained with ethidium bromide under UV light.
The MT-CYB gene from Elapsoidea semiannulata shares significant sequence homology with other elapid snakes, reflecting their evolutionary relationships. Comparative analysis reveals several important patterns:
Conservation and Variation: While certain regions of the MT-CYB gene are highly conserved across elapids, variable regions provide valuable phylogenetic signals. These variable regions have been instrumental in resolving relationships among elapid genera.
Phylogenetic Position: Molecular studies using complete cytochrome b sequences place Elapsoidea semiannulata within the African elapid clade. Specifically, analysis by Slowinski and Keogh integrated Elapsoidea semiannulata into their comprehensive phylogeny of elapid snakes .
Sequence Characteristics: The MT-CYB gene of Elapsoidea semiannulata, like other snake mitochondrial genes, exhibits base frequency biases typical of vertebrate mitochondrial DNA, with higher adenine and thymine content compared to guanine and cytosine.
Comparing MT-CYB sequences across elapid snakes has helped establish that marine elapids and Australo-Melanesian forms constitute a monophyletic group, with the relationships of African forms (including Elapsoidea) to American and Asian elapids being a subject of ongoing research .
Expression and purification of recombinant Elapsoidea semiannulata MT-CYB protein presents significant challenges due to its hydrophobic nature and membrane association. Based on established protocols for similar proteins, the following methodological approach is recommended:
Expression System Selection:
The E. coli BL21(DE3) strain with specialized vectors containing membrane protein-friendly features is generally recommended. Alternative systems such as yeast (P. pastoris) or insect cell lines may provide better folding for this complex membrane protein.
Optimization Protocol:
Construct Design: Include a fusion tag (His6 or GST) at the N-terminus with a TEV protease cleavage site.
Expression Conditions:
Induce at lower temperatures (16-18°C)
Use reduced IPTG concentrations (0.1-0.5 mM)
Extended expression time (16-24 hours)
Membrane Fraction Isolation: Use differential centrifugation following cell lysis.
Detergent Screening: Test multiple detergents including:
n-Dodecyl β-D-maltoside (DDM)
n-Octyl glucoside (OG)
Digitonin
Purification Strategy: Employ a two-step approach with immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography.
Special Considerations:
Cytochrome b is characterized by its ascorbate reducibility and trans-membrane electron transferring capability . Therefore, maintaining a suitable redox environment during purification is critical for preserving protein function. Including reducing agents such as DTT or β-mercaptoethanol in buffers at appropriate concentrations can help maintain the native state of the protein.
Identifying and characterizing mutations in the MT-CYB gene requires a systematic approach combining molecular techniques and bioinformatic analyses. The following comprehensive methodology is recommended:
Experimental Approach:
DNA Extraction: Utilize specialized kits for reptilian tissue to ensure high-quality DNA.
PCR Amplification: Use the standard primers and conditions outlined in section 1.2.
Sanger Sequencing: The ABI3500 (Applied Biosciences) instrument is commonly used for DNA sequencing. PCR products should be treated with exoSAP before sequencing .
Sequence Analysis: Utilize specialized software such as MITOMAP and Chromas Lite 2.1 for initial analysis .
Bioinformatic Analysis Pipeline:
For comprehensive mutation characterization, employ multiple prediction tools to assess the functional impact of identified variants:
| Bioinformatic Tool | Analysis Type | Output Metrics |
|---|---|---|
| PolyPhen-2 | Protein structure/function prediction | Probably damaging, possibly damaging, benign |
| PANTHER | Evolutionary analysis | Preservation score, subfunctionalization |
| SIFT | Sequence homology-based | Tolerated or deleterious |
| PROVEAN | Protein variation effect | Deleterious or neutral |
| Mutation Assessor | Functional impact | High, medium, low, neutral |
| SNAP | Neural network prediction | Effect or neutral |
| CADD | Combined annotation | Scaled C-scores |
Based on findings from similar studies on mtDNA mutations, mutations can be classified as synonymous (not altering amino acids) or missense (altering amino acids) . Utilizing these comprehensive tools enables researchers to distinguish between naturally occurring polymorphisms and potentially functionally significant mutations.
Analysis of phylogenetic relationships using MT-CYB data from Elapsoidea semiannulata faces several challenges that require sophisticated methodological solutions:
Key Challenges:
Saturation Effects: Multiple substitutions at the same site can mask phylogenetic signal, particularly at third codon positions of MT-CYB.
Base Composition Bias: Snake mtDNA exhibits base frequency biases (A: 0.363, C: 0.277, G: 0.145, T: 0.216) that can create analytical artifacts.
Rate Heterogeneity: Variation in evolutionary rates across sites complicates phylogenetic inference.
Gene Tree vs. Species Tree Discordance: MT-CYB represents only a single locus, which may not reflect the true species phylogeny due to incomplete lineage sorting or introgression.
Methodological Solutions:
Model Selection: Implement complex evolutionary models that account for rate heterogeneity with gamma distribution (G: 0.52) and proportion of invariant sites (I: 0.36) . The suggested model parameters include:
Multiple Inference Methods: Apply both maximum-parsimony and maximum-likelihood methods as done by Slowinski and Keogh to ensure robustness of results .
Bootstrap Analysis: Implement rigorous bootstrap analyses (2000+ replicates) to assess node support, with values above 80% considered strong support .
Multi-gene Approach: Combine MT-CYB with other genes such as 12S-16S rRNA and ND4 for a more comprehensive phylogenetic analysis .
Partitioned Analysis: Analyze codon positions separately or implement partitioned models to account for their different evolutionary dynamics.
By integrating these methodological approaches, researchers can overcome the limitations of MT-CYB data and develop more robust phylogenies for Elapsoidea semiannulata and related elapid snakes.
The spectral and redox properties of recombinant MT-CYB from Elapsoidea semiannulata exhibit distinctive characteristics compared to other cytochrome b proteins, reflecting both conserved functional domains and species-specific adaptations:
Spectral Properties:
Recombinant cytochrome b proteins typically display characteristic absorption peaks in UV-visible spectroscopy, with distinctive α, β, and Soret bands. For snake MT-CYB:
Oxidized State (Fe³⁺):
Soret band: 410-415 nm
α-band: 560-565 nm
β-band: 530-535 nm
Reduced State (Fe²⁺):
Soret band: 420-425 nm
α-band: 555-560 nm (more pronounced)
β-band: 525-530 nm
Redox Properties:
Cytochrome b proteins function as electron carriers within the respiratory chain. Key redox characteristics include:
Midpoint Potential: The midpoint reduction potential of snake MT-CYB typically ranges from -50 to +50 mV (vs. standard hydrogen electrode), reflecting the protein's role in the electron transport chain.
Ascorbate Reducibility: Like other cytochrome b561 proteins, Elapsoidea semiannulata MT-CYB demonstrates ascorbate reducibility, a defining feature of this cytochrome class .
Trans-membrane Electron Transfer: MT-CYB contains two heme centers positioned on opposite sides of the membrane, enabling electron transfer across the membrane bilayer .
These properties are critical for the protein's function in cellular respiration and have been conserved throughout evolution while allowing for species-specific adaptations that may reflect the physiological demands of different snake species.
The analysis of synonymous and non-synonymous mutations in MT-CYB provides crucial insights into the evolutionary forces shaping the genome of Elapsoidea semiannulata and related elapid snakes:
Mutation Patterns and Selection:
Synonymous Mutations: Studies of mtDNA have identified numerous synonymous substitutions in CYB genes, similar to what has been observed in other species. Examples of synonymous mutations include C15574T, T15310C, A15607G, G15301A, C15338T, T15454C, T15622C, and A15562G . These mutations do not alter amino acid sequences and are generally subject to less selective pressure.
Non-synonymous (Missense) Mutations: Mutations like G15431A (A229T), T15747C (I334T), and A15758G (I338V) result in amino acid changes . These mutations may affect protein function and are therefore subject to stronger selective constraints.
Evolutionary Significance:
| Mutation Type | Evolutionary Implication | Application in Research |
|---|---|---|
| Synonymous (silent) | Neutral evolution markers | Molecular clock calibration, population genetics |
| Conservative missense | Functional constraints | Identification of conserved domains |
| Radical missense | Adaptive evolution | Detection of positive selection |
dN/dS Ratio Analysis:
The ratio of non-synonymous to synonymous substitution rates (dN/dS) provides insights into the selective forces acting on the MT-CYB gene:
dN/dS < 1: Purifying selection (most common for essential genes)
dN/dS = 1: Neutral evolution
dN/dS > 1: Positive selection
Understanding these mutation patterns helps reconstruct the evolutionary history of Elapsoidea semiannulata and provides insights into the molecular mechanisms underlying adaptation in venomous snakes.
Obtaining high-quality DNA for MT-CYB analysis from Elapsoidea semiannulata requires careful consideration of sampling techniques and extraction methods:
Tissue Sampling:
Preferred Tissue Types:
Fresh liver tissue (optimal for high mtDNA yield)
Blood samples (less invasive for live specimens)
Shed skin (non-invasive alternative)
Scale clips (minimal impact sampling)
Preservation Methods:
Immediate flash freezing in liquid nitrogen (optimal)
Storage in 95-99% ethanol at -20°C
RNAlater™ solution for ambient temperature preservation
Silica gel desiccation for field conditions
In previous studies, researchers successfully used liver tissues or shed skins for elapid snake DNA extraction .
DNA Extraction Protocol:
Commercial Kits:
Qiagen DNeasy Blood & Tissue Kit (with modifications for reptile samples)
Macherey-Nagel NucleoSpin Tissue Kit
Critical Modifications for Snake Samples:
Extended lysis time (12-24 hours)
Increased Proteinase K concentration (20-40 μl)
Additional mechanical disruption for tough tissues
Reduced elution volume (50-100 μl) for higher DNA concentration
Quality Control Metrics:
260/280 ratio: 1.8-2.0 (protein contamination check)
260/230 ratio: >1.8 (organic compound contamination check)
Minimum concentration: 10-20 ng/μl for standard PCR
Following these best practices ensures the extraction of high-quality DNA suitable for reliable amplification and sequencing of the MT-CYB gene, thereby facilitating accurate phylogenetic and evolutionary studies of Elapsoidea semiannulata.
Fine-scale population analysis using MT-CYB sequence data requires sophisticated analytical approaches that can detect subtle genetic variation within Elapsoidea populations:
Data Generation and Processing:
High-fidelity Sequencing: Employ high-fidelity polymerases and bidirectional Sanger sequencing to minimize errors.
Sequence Validation: Apply stringent quality control with Phred scores >30 and manual verification of chromatograms using software like Chromas Lite 2.1 .
Alignment Strategy: Use MUSCLE or MAFFT algorithms with iterative refinement for accurate sequence alignment.
Population Genetic Analysis Framework:
| Analysis Level | Methods | Software Tools | Applications |
|---|---|---|---|
| Haplotype Identification | Sequence clustering | DnaSP, Arlequin | Identifying unique MT-CYB variants |
| Genetic Diversity | Nucleotide diversity (π), haplotype diversity (Hd) | MEGA, DnaSP | Quantifying population genetic variation |
| Population Structure | FST, AMOVA | Arlequin, GenAlEx | Detecting genetic differentiation |
| Demographic History | Mismatch distribution, neutrality tests (Tajima's D, Fu's Fs) | DnaSP, BEAST | Inferring historical population changes |
| Phylogeography | Nested clade analysis, spatial analysis | GeoDis, SAMOVA | Relating genetic patterns to geography |
| Coalescent Analysis | Bayesian skyline plots | BEAST | Estimating effective population size changes |
Analytical Considerations:
Incorporating Models: Apply appropriate nucleotide substitution models (similar to those used in phylogenetic studies with parameters: rate matrix [AC]: 2.79, [AG]: 4.91, [AT]: 2.17, [CG]: 0.57, [CT]: 16.35, [GT]: 1; proportion of invariant sites I: 0.36; gamma shape parameter G: 0.52) .
Mutation Rate Calibration: For demographic analyses, calibrate the MT-CYB mutation rate based on fossil records or biogeographical events relevant to Elapsoidea evolution.
Integration with Nuclear Markers: Complement MT-CYB data with nuclear markers to address potential limitations of using a single matrilineal locus.
This comprehensive analytical framework enables researchers to detect subtle genetic differentiation within Elapsoidea populations, understand their demographic history, and identify cryptic diversity that may inform conservation strategies for these venomous snakes.
Recombinant MT-CYB from Elapsoidea semiannulata offers unique opportunities for investigating the relationship between metabolic adaptation and venom evolution in elapid snakes:
Research Applications:
Metabolic-Venom Coevolution:
MT-CYB, as a key component of the electron transport chain, influences metabolic capacity. The energetic demands of venom production may have driven co-evolutionary adaptations in both venom genes and metabolic genes like MT-CYB. Recombinant MT-CYB can be used to measure metabolic efficiency differences between venomous and non-venomous lineages.
Molecular Clock Applications:
MT-CYB sequences provide reliable molecular clock estimates that can be correlated with the timing of venom gene family expansions. This correlation helps understand whether metabolic adaptations preceded or followed venom evolution.
Experimental Design Framework:
| Research Question | Experimental Approach | Expected Outcome |
|---|---|---|
| Do venom-producing tissues show metabolic adaptations? | Compare MT-CYB expression in venom gland vs. other tissues | Identification of tissue-specific isoforms |
| Are MT-CYB mutations correlated with venom potency? | Compare MT-CYB sequences across elapids with varying venom toxicity | Correlation between specific mutations and venom evolution |
| How does metabolic capacity influence venom production? | Measure oxygen consumption in tissues expressing wild-type vs. mutant MT-CYB | Understanding of metabolic constraints on venom production |
Structure-Function Relationships:
Recombinant MT-CYB proteins with specific mutations can be used to investigate how amino acid changes affect protein function, potentially revealing adaptations that support the high metabolic demands of venom production.
This integrated approach using recombinant MT-CYB provides a novel perspective on the evolution of venomous snakes by connecting metabolic adaptation with the development of their complex venom systems, offering insights beyond traditional studies focused solely on venom proteins.
Future research on MT-CYB variants in Elapsoidea semiannulata should focus on integrating molecular evolution with functional biology and ecological adaptation. The following priority areas represent promising avenues for research:
Priority Research Directions: