Recombinant Elastin-binding protein ebpS (ebpS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
ebpS; Elastin-binding protein EbpS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-486
Protein Length
Full Length of Mature Protein
Species
Staphylococcus aureus
Target Names
ebpS
Target Protein Sequence
SNNFKDDFEKNRQSIDTNSHQDHTEDVEKDQSELEHQDTIENTEQQFPPRNAQRRKRRRD LATNHNKQVHNESQTSEDNVQNEAGTIDDRQVESSHSTESQEPSHQDSTPQHEEGYYNKN AFAMDKSHPEPIEDNDKHETIKEAENNTEHSTVSDKSEAEQSQQPKPYFATGANQANTSK DKHDDVTVKQDKDESKDHHSGKKGAAIGAGTAGVAGAAGAMGVSKAKKHSNDAQNKSNSG KVNNSTEDKASEDKSKEHHNGKKGAAIGAGTAGLAGGAASNSASAASKPHASNNASQNND EHDHHDRDKERKKGGMAKVLLPLIAAVLIIGALAIFGGMALNNHNNGTKENKIANTNKNN ADESKDKDTSKDASKDKSKSTDSDKSKDDQDKATKDESDNDQNNANQANNQAQNNQNQQQ ANQNQQQQQQRQGGGQRHTVNGQENLYRIAIQYYGSGSPENVEKIRRANGLSGNNIRNGQ QIVIP
Uniprot No.

Target Background

Function
This recombinant elastin-binding protein ebpS promotes the binding of soluble elastin peptides and tropoelastin to *Staphylococcus aureus* cells. However, it does not facilitate bacterial adherence to immobilized elastin and is therefore not classified as a microbial surface component recognizing adhesive matrix molecule (MSCRAMM).
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the elastin-binding protein (ebpS) of Staphylococcus aureus?

EbpS is a cell surface protein that mediates specific binding between S. aureus and elastin, facilitating bacterial attachment to host tissues and organs. This interaction represents an important mechanism leading to colonization, invasion, and formation of metastatic abscesses during infection. Molecular analysis reveals that the ebpS gene consists of a 606 base pair open reading frame encoding a novel polypeptide with a predicted molecular mass of 23,345 daltons and an isoelectric point (pI) of 4.9 . This protein plays a crucial role in the early stages of infection by enabling bacterial adherence to elastin-rich tissues.

What is the molecular structure and topology of ebpS?

The elastin-binding proteins ebpS of S. aureus strains Cowan and 8325-4 comprise 486 residues according to sequence analysis. The protein contains three hydrophobic domains: H1 (residues 205-224), H2 (residues 265-280), and H3 (residues 315-342) .

Experimental analysis using hybrid proteins between ebpS and either alkaline phosphatase or β-galactosidase (EbpS-PhoA, EbpS-LacZ) has demonstrated that ebpS is an integral membrane protein with two membrane-spanning domains (H1 and H3) . The protein's topology shows that:

  • N-terminal residues 1-205 and C-terminal residues 343-486 are exposed on the outer face of the cytoplasmic membrane

  • The elastin-binding domain is located in the N-terminus between residues 14-34

  • This binding region is accessible on the surface of intact bacterial cells

  • The C-terminus, which carries a putative LysM peptidoglycan-binding domain, remains buried within the peptidoglycan

Where is ebpS localized in S. aureus cells and how can this be determined?

EbpS is found exclusively in cytoplasmic membrane fractions purified from protoplasts or lysed S. aureus cells. This localization differs from other adhesins like the clumping factor ClfA, which is cell-wall associated .

Researchers can determine this localization through:

  • Cell fractionation techniques that separate cytoplasmic membrane, cell wall, and cytoplasmic components

  • Western blotting of these fractions using specific anti-ebpS antibodies

  • Comparison with known membrane and cell wall markers

When analyzed by Western blotting, ebpS migrates with an apparent molecular mass of 83 kDa in wild-type S. aureus strains, which is considerably larger than its predicted size, suggesting potential post-translational modifications or unusual structural properties .

How does ebpS contribute to S. aureus pathogenesis?

EbpS contributes to S. aureus pathogenesis through multiple mechanisms:

  • Adhesion to host tissues: As demonstrated experimentally, wild-type S. aureus cells bind significantly more labeled tropoelastin than ebpS mutants, which show approximately 72% reduced binding capacity . This adhesion enables initial colonization of elastin-rich tissues.

  • Growth regulation: Expression of ebpS correlates with the ability of S. aureus to grow to higher cell densities in liquid culture, suggesting a role beyond simple adhesion—potentially in sensing the environment and regulating cellular proliferation .

  • Immune evasion: By facilitating adhesion to elastin, ebpS may contribute to biofilm formation and persistence within host tissues, potentially shielding bacteria from immune clearance.

These functions make ebpS an important virulence factor during multiple stages of infection, from initial attachment to proliferation within host tissues.

What methodologies are available for recombinant expression and purification of ebpS?

To express and purify recombinant ebpS for research purposes, the following methodological approach has been validated:

  • Gene amplification and cloning:

    • PCR amplification of the ebpS gene from S. aureus genomic DNA

    • Cloning into appropriate expression vectors, typically with affinity tags

  • Expression systems:

    • Escherichia coli is the validated expression host, with successful expression of both full-length protein and specific domains

    • Specifically, researchers have successfully expressed the N-terminal domain (residues 1-267) and C-terminal domain (residues 343-486) as recombinant proteins in E. coli

  • Purification strategy:

    • Affinity chromatography using engineered tags (researchers have successfully used this approach to isolate recombinant ebpS for functional studies)

    • Verification of purity by SDS-PAGE analysis

  • Functional validation:

    • Recombinant ebpS binds specifically to immobilized elastin in solid-phase binding assays

    • Purified recombinant protein can inhibit binding of intact S. aureus to elastin, confirming its biological activity

This expression system has been critical for obtaining sufficient quantities of purified protein for structural and functional analyses, antibody production, and inhibition studies.

How can researchers map the elastin-binding domain of ebpS?

Mapping the elastin-binding domain of ebpS has been accomplished through multiple complementary approaches:

  • Truncation analysis: Experiments with degradation products of recombinant ebpS have shown that fragments lacking the first 59 amino acids fail to bind elastin. Similarly, C-terminal fragments of CNBr-cleaved recombinant ebpS do not interact with elastin, indicating that the binding site is located within the N-terminal region .

  • Hybrid protein construction: Creating fusion proteins between ebpS and reporter enzymes (alkaline phosphatase or β-galactosidase) at strategic points has helped determine both protein topology and the accessibility of binding domains .

  • Antibody inhibition studies: Antibodies raised against the N-terminal domain (residues 1-267) can block elastin binding by intact bacteria, confirming the location and surface accessibility of this region .

  • Direct binding assays: Probing whole cells with anti-EbpS1-267 antibodies has demonstrated that the N-terminal region containing residues 14-34 is exposed on the bacterial surface and accessible for elastin binding .

Through these complementary approaches, researchers have determined that the elastin-binding site in ebpS is contained within the first 59 amino acids of the molecule, more specifically in the region between residues 14-34 in the N-terminal domain .

What experimental approaches can be employed to study ebpS functionality?

Several experimental approaches can be used to investigate ebpS functionality:

  • Genetic manipulation:

    • Generation of ebpS knockout mutants through allelic replacement

    • Complementation studies with wild-type or modified ebpS to confirm phenotype restoration

    • Site-directed mutagenesis of key residues in the binding domain

  • Binding assays:

    • Solid-phase binding assays using immobilized elastin and recombinant ebpS

    • Competition experiments where recombinant ebpS inhibits binding of intact S. aureus to elastin

    • Flow cytometry with fluorescently labeled tropoelastin to quantify binding to bacterial cells

  • Antibody inhibition:

    • Generation of polyclonal antibodies against recombinant ebpS

    • Inhibition of elastin binding through antibody blockade, which has been demonstrated to reduce staphylococcal adherence to elastin

  • Growth and biofilm studies:

    • Comparison of growth curves between wild-type and ebpS mutants

    • Assessment of biofilm formation on elastin-coated surfaces

    • Correlation between ebpS expression and bacterial cell density in culture

  • Immunological detection:

    • Western blotting to assess expression levels under different conditions

    • Immunofluorescence microscopy to visualize ebpS distribution on bacterial cells

    • ELISA assays to quantify antibody responses against ebpS in patient samples

These approaches have revealed that wild-type S. aureus cells bind significantly more labeled tropoelastin than ebpS mutants (which showed 72% reduced binding), confirming the protein's critical role in elastin interaction .

How does the antibody response against ebpS differ between healthy individuals and patients with S. aureus infections?

Serological studies have revealed important differences in antibody responses against ebpS between healthy individuals and patients with S. aureus infections:

  • Baseline responses in healthy individuals:

    • Healthy adults show a wide range of antistaphylococcal antibody levels, including antibodies against ebpS

    • Approximately 2.5-3.0% of total serum IgG antibodies in high-titer sera from healthy individuals react with staphylococcal antigens

    • These antibody levels remain stable for years in healthy individuals, suggesting long-term immunological memory

  • Responses in patients with S. aureus infections:

    • Significantly higher levels of IgG antibodies against ebpS are measured in patients with acute staphylococcal infections compared to healthy adults

    • This indicates that ebpS is immunogenic during natural infection and stimulates a specific antibody response

  • Functional properties of antibodies:

    • Antibodies from healthy individuals demonstrate opsonophagocytic and neutralizing activity in vitro

    • Polyclonal antibodies raised against recombinant ebpS can inhibit staphylococcal elastin binding, suggesting potential protective functions

This comparative analysis of antibody profiles provides insight into the immunogenicity of ebpS during natural infection and suggests this protein could be a potential target for vaccine development or immunotherapeutic approaches.

What role does ebpS play in S. aureus nasal carriage and how can this be studied?

The relationship between ebpS and S. aureus nasal carriage presents an interesting research area:

  • Carriage patterns and antibody levels:

    • Interestingly, higher levels of antibodies against certain S. aureus proteins, including IgG against ebpS, have been observed in individuals who repeatedly test negative for S. aureus in nasal and pharyngeal swab cultures compared to those who are intermittent or permanent carriers

    • This suggests that these antibodies may play a protective role against colonization

  • Methodological approaches to study this relationship:

    • Longitudinal studies with serial sampling to determine carrier status

    • ELISA measurement of anti-ebpS antibody levels in serum samples

    • Correlation analysis between antibody titers and carriage status

    • Functional assays to assess the neutralizing capacity of these antibodies against ebpS-mediated adhesion

  • Experimental models:

    • Human nasal epithelial cell cultures to study adhesion mediated by ebpS

    • Animal models of nasal colonization comparing wild-type and ebpS-deficient strains

    • Ex vivo binding assays using nasal tissue samples with elastin-rich components

Understanding the role of ebpS in nasal carriage could provide valuable insights into colonization mechanisms and inform strategies to prevent S. aureus carriage, which is a risk factor for subsequent infection.

How can researchers identify immunodominant epitopes of ebpS for vaccine development?

Identification of immunodominant epitopes in ebpS follows several methodological approaches:

  • Epitope mapping techniques:

    • Selection of epitopes from genomic peptide expression libraries using high-titer sera from individuals with strong antibody responses

    • Synthetic peptide arrays covering the entire ebpS sequence

    • Evaluation by ELISA using synthetic peptides corresponding to identified epitopes

  • Comparative analysis of antibody responses:

    • Testing sera from both infected patients and healthy individuals against identified epitopes

    • Analyzing responses in individuals with different outcomes of staphylococcal infections

    • Identifying epitopes recognized by functionally protective antibodies

  • Structural considerations:

    • Focus on surface-exposed regions, particularly within the N-terminal elastin-binding domain

    • Consideration of conformational versus linear epitopes

    • Assessment of epitope conservation across different S. aureus strains

  • Functional validation:

    • Testing whether antibodies against specific epitopes can block elastin binding

    • Evaluation of opsonophagocytic activity mediated by epitope-specific antibodies

    • Assessment of protection in animal models

Research has shown that the majority of identified epitopes in S. aureus proteins, including those in ebpS, belong to surface-located or secreted proteins, making them potentially valuable targets for vaccine development .

What are the challenges in studying structure-function relationships of ebpS and how can they be addressed?

Researchers face several challenges when investigating ebpS structure-function relationships:

  • Membrane protein complexity:

    • Challenge: As an integral membrane protein with multiple hydrophobic domains, ebpS is difficult to express, purify, and crystallize in its native conformation

    • Solution: Expression of specific soluble domains (such as the N-terminal binding region) or use of membrane mimetics for structural studies

  • Size discrepancy:

    • Challenge: The apparent molecular mass of ebpS in SDS-PAGE (83 kDa) differs significantly from its predicted size (23-25 kDa)

    • Solution: Analysis of post-translational modifications, alternative splicing, or unusual migration patterns using mass spectrometry and other protein characterization techniques

  • Topology determination:

    • Challenge: Establishing the precise orientation and membrane insertion of ebpS domains

    • Solution: Hybrid protein approach with reporter enzymes (PhoA, LacZ) fused at strategic points has successfully mapped topology

  • Functional redundancy:

    • Challenge: S. aureus possesses multiple adhesins that may have overlapping functions

    • Solution: Generation of multiple mutants lacking various combinations of adhesins to delineate specific contributions of ebpS

  • In vivo relevance:

    • Challenge: Translating in vitro binding observations to clinical significance

    • Solution: Animal models of infection comparing wild-type and ebpS-deficient strains in elastin-rich tissues

By addressing these challenges with appropriate methodological approaches, researchers can better understand the structure-function relationships of this important adhesin.

What is the dual role of ebpS in adhesion and growth regulation?

Beyond its function as an adhesin, ebpS appears to play a role in bacterial growth regulation:

  • Experimental evidence:

    • Expression of ebpS correlates with the ability of S. aureus cells to grow to higher densities in liquid culture

    • This suggests that ebpS may have functions beyond simple adhesion to elastin

  • Potential mechanisms:

    • Environmental sensing: ebpS might function as a sensor for elastin in the surroundings, triggering growth-promoting pathways

    • Membrane integrity: As an integral membrane protein, ebpS could influence membrane properties affecting cell division

    • Nutritional acquisition: Binding to elastin might facilitate uptake of elastin-derived peptides as nutrients

    • Signaling pathway activation: Interaction with elastin could trigger intracellular signaling cascades affecting gene expression

  • Methodological approaches to study this dual functionality:

    • Growth curve analysis comparing wild-type and ebpS mutants under various conditions

    • Transcriptomic and proteomic profiling to identify differentially regulated pathways

    • Construction of domain-specific mutants to separate adhesion and growth regulation functions

    • Conditional expression systems to control ebpS levels and observe effects on growth

Understanding this dual role provides insight into how S. aureus adapts to elastin-rich environments within the host, potentially linking colonization (adhesion) to proliferation (growth) during infection progression.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.