Recombinant Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

Recombinant RnfE is typically expressed in Escherichia coli with an N-terminal His tag for affinity purification. Examples from published datasets include:

Table 1: Recombinant RnfE Variants

OrganismUniProt IDProtein Length (aa)SourceTagReference
Magnetospirillum magneticumQ2W4031–223E. coliHis
Haemophilus influenzaeQ570201–235E. coliHis
Pseudoalteromonas atlanticaQ15RL01–232E. coliHis

These constructs enable biochemical studies, including ion transport assays and structural analysis .

Functional Insights from Research

  • Role in Ion Translocation: RnfE collaborates with RnfD to form a Na+ channel in Acetobacterium woodii, facilitating electrogenic Na+ transport driven by ferredoxin:NAD+ oxidoreductase activity .

  • Electron Transport Coupling: In Thermotoga maritima, RnfE stabilizes interactions between the ferredoxin-binding RnfB and NAD+-reducing RnfC subunits, ensuring efficient electron flux .

  • Energy Conservation: Deletion of rnfE disrupts the Rnf complex’s ability to generate a proton motive force, impairing growth under autotrophic conditions .

Evolutionary and Biotechnological Significance

  • Evolution: RnfE shares homology with subunits of the Na+-translocating NADH:ubiquinone oxidoreductase (Nqr), suggesting a common ancestral ion-transport module .

  • Applications: Recombinant RnfE is used to engineer synthetic electron transport chains for bioenergy applications, such as enhancing H2 production in Rhodobacter capsulatus .

Key Research Challenges

  • Structural Resolution: No high-resolution structures of full-length RnfE exist; current models rely on homology predictions .

  • Mechanistic Details: The exact residues involved in ion coordination and electron transfer remain unverified experimentally .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
rsxE; STY1668; t1322; Ion-translocating oxidoreductase complex subunit E; Rsx electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Salmonella typhi
Target Names
rsxE
Target Protein Sequence
MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSALR RWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPWLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDGADSLLGGWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAVKYLIDEKMKKRRAETAPSAVPAGETGKV
Uniprot No.

Target Background

Function
RnfE is a component of a membrane-bound complex that couples electron transfer with the translocation of ions across the membrane. It is essential for maintaining the reduced state of SoxR.
Database Links

KEGG: stt:t1322

STRING: 220341.STY1668

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Rnf complex and where does RnfE fit within its structure?

The Rnf (Rhodobacter nitrogen fixation) complex is a membrane-bound electron transport complex found in prokaryotes that energetically couples the cellular ferredoxin to the pyridine nucleotide pool, operating in the redox range more negative than -320 mV . This complex is architecturally similar to the electrogenic NADH:ubiquinone reductase complex (Nqr) . The Rnf complex consists of six protein subunits: RnfA, RnfB, RnfC, RnfD, RnfE, and RnfG.

RnfE is a 21 kDa integral membrane protein containing 5-7 predicted transmembrane (TM) helices . Within the complex structure, RnfE shares sequence similarities with NqrD from the Nqr complex . RnfE functions as one of the three integral membrane proteins (alongside RnfA and RnfD) that form the core membrane-embedded portion of the complex, providing a structural framework for ion translocation coupled to electron transfer.

What experimental approaches can verify the expression of functional recombinant RnfE?

Verification of functional recombinant RnfE expression requires multiple complementary approaches:

  • Protein expression verification: Western blotting using antibodies specific to RnfE or to added epitope tags confirms the presence of the protein at the expected molecular weight (21 kDa) .

  • Membrane localization assessment: Subcellular fractionation followed by immunoblotting can confirm proper membrane integration of RnfE. Fluorescence microscopy using GFP-tagged RnfE constructs can visually confirm membrane localization in intact cells.

  • Functional assays: Testing membrane preparations containing recombinant RnfE for ferredoxin:NAD+ oxidoreductase (Fno) activity and ferricyanide-dependent NADH oxidation activity . A functional RnfE should contribute to these activities when properly integrated with other Rnf components.

  • Complementation studies: Introducing recombinant RnfE into RnfE-deficient strains should restore function if the recombinant protein is properly expressed and functional.

How should researchers design experiments to study RnfE function within the complete Rnf complex?

Designing experiments to study RnfE function requires careful consideration of the following methodological approaches:

  • Control group vs. experimental group design: Implement true experimental designs with random assignment of samples to control and experimental groups to establish causality in RnfE function studies . For example, compare wild-type strains with RnfE knockout mutants, or complement the knockout with various RnfE mutants to assess specific functional domains.

  • Variable manipulation strategies: Systematically manipulate independent variables such as expression levels, growth conditions, or specific mutations in RnfE to observe effects on dependent variables like electron transport activity, ion translocation, or cell growth .

  • Multicomponent expression systems: Since RnfE functions within the complete Rnf complex, co-expression of all six Rnf proteins (RnfA, RnfB, RnfC, RnfD, RnfE, and RnfG) is often necessary to study authentic function. Design expression vectors containing all components with appropriate stoichiometry.

  • Reconstitution approaches: Purify individual Rnf components and reconstitute them in liposomes to study the role of RnfE in a controlled membrane environment, monitoring ion translocation and electron transport activities.

Experimental ApproachAdvantagesLimitationsSuitable Sample Size
In vivo knockout studiesPhysiological relevancePotential compensatory mechanismsn > 10 biological replicates
In vitro reconstitutionControlled environmentMay not reflect native conditionsn > 5 technical replicates
Site-directed mutagenesisTarget specific functional residuesMay disrupt protein foldingn > 10 mutants for comprehensive analysis
Cross-linking studiesCaptures protein-protein interactionsMay introduce artifactsn > 3 independent experiments

What are effective methods for isolating and purifying recombinant RnfE given its transmembrane nature?

Isolation and purification of recombinant RnfE presents significant challenges due to its hydrophobic transmembrane domains. Effective methodological approaches include:

  • Expression system selection: E. coli C41(DE3) or C43(DE3) strains are recommended for membrane protein expression as they better tolerate the toxic effects of membrane protein overexpression. Alternatively, homologous expression in native hosts may preserve functionality.

  • Detergent screening: A systematic detergent screening approach is critical for membrane protein extraction. Begin with mild detergents like DDM (n-dodecyl-β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) that better preserve protein structure and function.

  • Purification strategy: Implement a multi-step purification process:

    • Membrane isolation via ultracentrifugation

    • Solubilization in optimal detergent

    • Affinity chromatography using engineered tags (His, FLAG, etc.)

    • Size exclusion chromatography to separate monomeric RnfE from aggregates

    • Ion exchange chromatography for final polishing

  • Validation methods: Confirm protein purity using SDS-PAGE, Western blot, and mass spectrometry. Assess structural integrity using circular dichroism spectroscopy to verify secondary structure content.

Research has shown that comprehensive purification of the Rnf complex has been hampered by difficulties in preparing homogeneous protein complexes . When attempting to isolate RnfE specifically, researchers should consider whether to study it in isolation or as part of the complete complex, as contextual interactions may be essential for proper folding and function.

How can researchers assess RnfE's contribution to ion translocation in the Rnf complex?

Assessing RnfE's specific contribution to ion translocation requires sophisticated biophysical and biochemical approaches:

  • Liposome reconstitution assays: Reconstitute purified RnfE (alone or with other Rnf components) into liposomes loaded with ion-sensitive fluorescent dyes to measure ion (Na+ or H+) transport directly. Compare wild-type RnfE with mutant variants to identify key residues involved in ion translocation.

  • Electrophysiological measurements: Implement patch-clamp techniques on membrane fragments containing RnfE or the complete Rnf complex to directly measure ion currents. This approach requires specialized equipment but provides direct evidence of ion translocation.

  • Site-directed mutagenesis: Create systematic mutations in predicted transmembrane regions of RnfE, particularly those sharing homology with the Na+-transporting subunit NqrD . Analyze the effects on ion transport and electron transfer activities.

  • Ion specificity determination: The Rnf complex was initially presumed to be a Na+ pump since its discovery . Design experiments with varying ion compositions to definitively determine whether RnfE contributes to Na+ or H+ translocation, using ion-specific indicators and selective ionophores as controls.

What experimental designs are suitable for investigating interactions between RnfE and other Rnf complex components?

Investigating protein-protein interactions involving RnfE requires specialized experimental designs:

  • Cross-linking followed by mass spectrometry: Apply chemical cross-linkers to stabilize transient interactions before complex dissociation during purification. MS analysis can identify interacting regions between RnfE and other Rnf components.

  • Split reporter assays: Engineer fusion constructs of RnfE and potential interaction partners with split fluorescent or enzymatic reporters. Interaction reconstitutes the reporter activity, providing a readout for protein association.

  • FRET/BRET analysis: Tag RnfE and interaction partners with appropriate donor/acceptor fluorophores or bioluminescent proteins to measure proximity-dependent energy transfer, indicating direct interaction.

  • Co-immunoprecipitation with progressive truncations: Design a series of RnfE truncation mutants to map specific interaction domains with other Rnf subunits.

Interaction Analysis MethodDetection PrincipleSuitable for Transmembrane InteractionsResolution Level
Cross-linking MSCovalent bond formation between proximal residuesYesAmino acid residue
Co-immunoprecipitationAntibody-mediated complex isolationLimitedProtein level
FRET/BRETEnergy transfer between fluorophoresYes1-10 nm proximity
Split reporter systemsFunctional complementationLimitedProtein domain

For transmembrane proteins like RnfE, membrane environment preservation is crucial during interaction studies. Consider using nanodiscs or native membrane environments rather than detergent solubilization when possible to maintain physiologically relevant interactions.

How should researchers address contradictory results in RnfE functional studies?

When confronting contradictory results in RnfE research, implement these methodological approaches:

  • Systematic variable analysis: Identify all experimental variables that differ between contradictory studies, including expression systems, purification methods, buffer compositions, and assay conditions. Systematically test each variable to identify the source of discrepancy.

  • Independent validation: Employ multiple, orthogonal techniques to measure the same parameter. For example, if ion translocation results are contradictory, validate using both fluorescence-based methods and direct electrophysiological measurements.

  • Meta-analysis approach: When sufficient literature exists, conduct a formal meta-analysis of published RnfE studies to identify patterns and potential moderator variables explaining contradictory outcomes .

  • Organism-specific differences: RnfE function may vary between different prokaryotic species. The Rnf complex is found in diverse organisms and may have evolved different functional characteristics . Always clearly delineate the source organism in your experimental design and avoid generalizing findings across species without validation.

  • Collaborative cross-laboratory validation: Establish a standardized protocol and implement it across multiple laboratories to determine whether contradictions arise from subtle methodological differences or represent true biological variability.

What statistical approaches are most appropriate for analyzing RnfE functional data?

The appropriate statistical analysis depends on experimental design and data characteristics:

  • For comparing activity between wild-type and mutant RnfE:

    • ANOVA followed by post-hoc tests for comparing multiple groups

    • t-tests for pairwise comparisons with correction for multiple comparisons

    • Non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) if normality assumptions are violated

  • For dose-response relationships:

    • Regression analysis with appropriate models (linear, sigmoidal)

    • EC50/IC50 calculations with confidence intervals

    • Area under the curve (AUC) comparisons for time-course data

  • For interaction studies:

    • Binding curve analysis using appropriate models (one-site, two-site, cooperative)

    • Statistical comparison of fitted parameters (Kd, Bmax)

    • Correlation analysis for co-localization studies

  • Sample size considerations:

    • For detailed biochemical characterization, n ≥ 3 independent preparations is minimal

    • For complex functional studies, power analysis should guide sample size, typically requiring n ≥ 5

    • Small sample studies (n = 10) should focus on effect size estimation rather than significance testing alone

What are the recent methodological advances in studying RnfE and the Rnf complex?

Recent methodological advances have significantly enhanced our ability to study RnfE:

  • Cryo-electron microscopy: Recent advances in cryo-EM technology now permit the structural determination of membrane protein complexes at near-atomic resolution. This technique can potentially resolve the structure of the entire Rnf complex, including RnfE's position and conformation within it.

  • Native mass spectrometry: Development of specialized MS techniques that can analyze intact membrane protein complexes provides insights into the stoichiometry and stability of RnfE within the Rnf complex.

  • Genome engineering tools: CRISPR-Cas9 systems adapted for prokaryotes allow precise genomic modifications to study RnfE in its native context, including introduction of point mutations, domain swaps, or fusion tags without disrupting native expression levels.

  • Nanobody development: Engineering of camelid-derived single-domain antibodies (nanobodies) against RnfE provides highly specific tools for detection, purification, and potentially crystallization of this challenging membrane protein.

  • Computational approaches: Advanced molecular dynamics simulations can now model membrane proteins like RnfE within lipid bilayers, predicting conformational changes during ion translocation and electron transfer events.

How can researchers design experiments to investigate the evolutionary relationships between RnfE and related proteins?

Investigating evolutionary relationships of RnfE requires specialized experimental designs:

  • Comparative functional analysis: Express RnfE orthologs from diverse prokaryotic species in a model organism lacking endogenous Rnf components. Assess functional conservation through growth complementation and biochemical assays.

  • Domain-swapping experiments: Create chimeric proteins combining domains from RnfE and its homologs (such as NqrD) to identify which regions confer specific functions, providing insight into evolutionary divergence and functional specialization.

  • Ancestral sequence reconstruction: Computationally reconstruct ancestral RnfE sequences based on phylogenetic analysis, then express and characterize these reconstructed proteins to understand functional evolution.

  • Co-evolution analysis: Identify co-evolving residues within RnfE and between RnfE and other Rnf components using statistical coupling analysis. These residues often indicate functional or structural importance.

RnfE HomologOrganism TypeSequence Identity to E. coli RnfEFunctional Equivalence
NqrDAerobic bacteria25-35%Na+ transport only
HyfDAnaerobic bacteria20-30%H+ transport, different electron carriers
MbhDArchaea15-25%Limited functional equivalence

The evolutionary relationship between RnfE and NqrD is of particular interest, as RnfE shares sequence similarities with NqrD, which is part of the Na+-translocating NADH:ubiquinone oxidoreductase complex (Nqr) . This relationship suggests convergent evolution of ion-motive force generation from different electron transport processes.

What are the most promising future research directions for RnfE and the Rnf complex?

The study of RnfE and the Rnf complex presents several promising research frontiers:

  • Structural biology: Resolving the high-resolution structure of RnfE within the complete Rnf complex would dramatically advance our understanding of its mechanism. Current challenges in purifying homogeneous Rnf complexes must be overcome to achieve this goal .

  • Synthetic biology applications: Engineered Rnf complexes with modified RnfE components could potentially create microorganisms with enhanced bioenergetic capabilities for biotechnological applications, particularly in low-redox potential environments.

  • Antimicrobial target exploration: As the Rnf complex is essential in many pathogenic bacteria but absent in humans, RnfE could represent a novel target for antimicrobial development. Structure-based drug design targeting RnfE could yield highly specific antibiotics.

  • Electron bifurcation mechanisms: Further investigation into how the Rnf complex, including RnfE, contributes to electron bifurcation processes is needed to fully understand microbial energy conservation strategies.

  • Systems biology integration: Understanding how RnfE and the Rnf complex interact with other cellular systems through large-scale omics approaches would provide insights into the global regulation of microbial bioenergetics and metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.