Recombinant Elephantid herpesvirus 1 Glycoprotein H

Shipped with Ice Packs
In Stock

Description

Role of Glycoprotein H in Herpesviruses

gH, along with other glycoproteins like gB and gL, plays a crucial role in the herpesvirus entry process . Specifically, gH forms a heterodimer with gL, acting as an activator of gB and potentially functioning in receptor binding . These glycoproteins are also important targets of the herpesvirus-specific humoral immune response, making them interesting for use in serological assays .

Recombinant Production and Significance

Expression of recombinant EEHV gH/gL has been achieved in mammalian cells, allowing for the purification of the protein . This is significant because the recombinant proteins can be used as antigens in enzyme-linked immunosorbent assays (ELISAs) to detect EEHV-specific antibodies in elephant sera . The ability to produce and purify recombinant EEHV1A gB and gH/gL has improved diagnostic tools for EEHV infection in elephants .

Diagnostic Applications

ELISAs based on recombinant EEHV1A gB and gH/gL have been developed to assess the prevalence of EEHV in elephant populations . Studies using these ELISAs have shown high reactivity with sera from (sub)adult elephants, indicating that EEHV prevalence has been underestimated . In contrast, sera from juvenile animals often show lower reactivity, suggesting primary infections may occur in younger elephants .

Vaccine Development

Glycoprotein B (gB) is also a target for vaccine development against EEHV . A Modified Vaccinia Ankara (MVA) recombinant virus expressing a truncated form of gB from EEHV1A has been shown to stimulate robust humoral and cell-mediated immune responses in mice . These findings suggest that gB, and potentially gH, could be used in vaccines to prevent lethal EEHV-HD infection .

Prevalence of EEHV

Studies utilizing ELISAs with gB and gH/gL antigens have provided insights into the prevalence of EEHV . A study showed that all subadult (between 5 and 15 years of age) and adult elephants (≥15 years of age) living under human care in European zoos or in Laos were seropositive for EEHV . Additionally, EEHV-HD cases tested had low or non-detectable EEHV-specific antibody titers, suggesting these animals experienced primary infections .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
gH; Envelope glycoprotein H; gH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-737
Protein Length
Full Length of Mature Protein
Species
Elephantid herpesvirus 1 (isolate Asian elephant/Berlin/Kiba/1998) (EIHV-1) (Elephant endotheliotropic herpesvirus)
Target Names
gH
Target Protein Sequence
AFDLSHVHSESCLKIQDISSDTINFTPNLVMFRFFSNETHSDVFHLPKCIFDSKLTSYLF DHLNIYEDVSVYKNNFEKYYMGSVEGTYRTIIIKGEDTTPYLDKTTAPTVEITEKDLIIT YQGIRYMNPFPVLSLIDDESCEVFDDINELILPYFGKCRKFYLNFGSVTLFGHITSNFVT IKYTAQNGTDPYTIRLFFGNSAEIVHTLPFEAQDLALRMMMYDDFEIIGEVGPVKEMLKS FKLSLLDSLLEQNHEDVMNDFRHVFEAFYNHIKKIRDGSIDIKSLHIEQLLDSLLAYSIG YYIQYRYPPYTGKWRGIEHFIETETYIHMVPELFDLFAHNMTVKTPTRPNAIKFINILIR LYSYTDYTKLDHRGLSLYFLKYIYQGNVTDDIATYAHRYMTNLYTKYTYPKTQEGEHLYK SYNDSLDTFILNTIGLKSKNKTLLHHILLLQTGMCNIQNMIGHFHSLQNNDPKFGALLSP CYRSLRYDLTAKKIGQLITKESLEPYGRLVNMVRFMTKNSSMLNVLKCELPEDDGLLAIA TVDNKTYIISSRPIAVGVVYKATYTAINLFLYVTRIQNNTCIHIDKVYRDGDVKAVYTFS LDTAKDCGDMCPSVLVEYQTNTGFIGIHVINSIADIQYISENRKLFPESSHYLWLLKNDT VLELEGTNFFLFSSKSPGAIVLYIIIISLIVWTLYEIIKLFCYKRQWQYQKL
Uniprot No.

Target Background

Function

The heterodimeric glycoprotein H-glycoprotein L complex is essential for the fusion of viral and host cell plasma membranes, a critical step in viral entry. Following initial receptor binding, membrane fusion is facilitated by the fusion machinery comprising gB and the gH/gL heterodimer. This complex may also play a role in the fusion between the virion envelope and the outer nuclear membrane during virion morphogenesis.

Protein Families
Herpesviridae glycoprotein H family
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein. Host endosome membrane; Single-pass type I membrane protein.

Q&A

What is Elephant Endotheliotropic Herpesvirus 1 (EEHV1) and what is its significance in elephant health?

EEHV is one of the most devastating viral infectious diseases affecting elephants worldwide, particularly young Asian elephants (Elephas maximus). It belongs to the family Herpesviridae, subfamily Betaherpesvirinae, genus Proboscivirus, and species Elephantid betaherpesvirus. Eight genotypes (EEHV1A, EEHV1B, and EEHV2-7) have been identified, with EEHV1A, EEHV1B, EEHV4, and EEHV5 associated with severe hemorrhagic disease in Asian elephants . This virus can cause acute, often lethal, hemorrhagic disease (EEHV-HD) in young elephants, making it a critical area of research for elephant conservation and health management .

What is the role of Glycoprotein H in the EEHV infection process?

Glycoprotein H (gH) plays a crucial role in the EEHV infection cycle. It functions as part of a heterodimer with Glycoprotein L (gL) to facilitate viral entry into host cells. The gH/gL complex acts as an activator of Glycoprotein B (gB) and may function in receptor binding . Studies have shown that gH is a 737 amino acid protein that is essential for the viral entry process . As a component of the viral envelope, gH is directly involved in the fusion of the viral envelope with the host cell membrane, making it a critical protein in establishing infection.

How prevalent is EEHV among elephant populations?

EEHV is significantly more prevalent than previously estimated. According to recent serological studies using ELISAs based on recombinant EEHV1A gB and gH/gL, all subadult (between 5 and 15 years of age) and adult elephants (≥15 years of age) tested from both European zoos (n = 34) and an Asian elephant range country (Laos, n = 69) were seropositive for EEHV . This indicates that EEHV infection is essentially omnipresent in elephant populations, with most animals encountering the virus by adulthood. The prevalence in juvenile animals (1-5 years) is generally lower, suggesting that exposure typically occurs as elephants mature .

What are the structural characteristics of EEHV1 Glycoprotein H?

EEHV1 Glycoprotein H is a transmembrane protein encoded by the U48 gene in the viral genome. Based on genomic analyses, gH in EEHV1 consists of 737 amino acids and shows significant divergence between EEHV genotypes. For instance, when comparing EEHV1 with EEHV2, the gH protein exhibits about 31-34% nucleotide divergence and approximately 40% amino acid divergence . The protein contains conserved domains that are essential for its function in viral entry. Glycoprotein H is part of a conserved core set of glycoproteins found in all herpesviruses, emphasizing its functional importance in the viral life cycle.

What genomic regions encode EEHV1 Glycoprotein H and how variable are they across EEHV genotypes?

The EEHV1 Glycoprotein H is encoded by the U48 gene of the viral genome. According to genomic analyses, this gene is located at positions 103692-105911 in the EEHV1A (Kimba) genome . The U48 gene exhibits substantial variability between different EEHV genotypes. For example, there is approximately 31% nucleotide divergence between EEHV1A and EEHV2, and about 34% nucleotide divergence between EEHV1B and EEHV2. At the amino acid level, this translates to approximately 40% divergence between these genotypes . This variability may affect antigenic properties and could have implications for diagnostic test development and cross-protection.

What expression systems are recommended for producing recombinant EEHV1 Glycoprotein H?

Mammalian cell expression systems are strongly recommended for producing recombinant EEHV1 Glycoprotein H due to the need for proper protein folding and post-translational modifications. Recent research has successfully employed mammalian cell systems for the production of secreted recombinant EEHV1A gH/gL . This approach is preferable to bacterial expression systems (such as E. coli) for complex glycoproteins like gH, as mammalian cells provide the cellular machinery necessary for appropriate glycosylation and folding. When designing expression constructs, researchers should consider including features that facilitate secretion and purification, such as signal peptides and affinity tags that don't interfere with protein structure or function.

What are the key challenges in producing functional recombinant EEHV1 Glycoprotein H?

Producing functional recombinant EEHV1 Glycoprotein H presents several challenges:

  • Protein complexity: gH forms a heterodimer with gL, requiring co-expression of both proteins for proper folding and functionality.

  • Post-translational modifications: As a complex glycoprotein, gH requires appropriate glycosylation for correct folding and function.

  • Solubility issues: Membrane proteins like gH often have hydrophobic domains that can cause aggregation and insolubility.

  • Purification difficulties: Maintaining the native conformation during purification is challenging.

  • Yield limitations: Expression levels of complex viral glycoproteins are often lower than those of simpler proteins.

Researchers have overcome some of these challenges by using mammalian expression systems and carefully designing expression constructs to produce secreted forms of the protein . Co-expression with gL appears to be critical for obtaining properly folded and functional gH protein.

What purification methods are most effective for recombinant EEHV1 Glycoprotein H?

For purifying recombinant EEHV1 Glycoprotein H, affinity chromatography is typically the method of choice, particularly when the recombinant protein is tagged (e.g., with a His-tag). Based on related herpesvirus glycoprotein purification methods and information from the search results, a multi-step purification process is recommended:

  • Initial capture using affinity chromatography (e.g., Ni-NTA for His-tagged proteins)

  • Buffer exchange to remove imidazole or other elution agents

  • Ion exchange chromatography for further purification

  • Size exclusion chromatography to separate aggregates from properly folded protein

When purifying the gH/gL complex, it's essential to use conditions that maintain the integrity of the heterodimer. Mild detergents may be necessary if the construct includes transmembrane domains. For storage, adding glycerol (typically 5-50%, with 50% being optimal for long-term storage) and storing at -20°C/-80°C is recommended to maintain protein stability .

How can recombinant EEHV1 Glycoprotein H be used to develop serological diagnostic tests?

Recombinant EEHV1 Glycoprotein H, especially when produced as a complex with Glycoprotein L (gH/gL), serves as an excellent antigen for developing serological diagnostic tests. Researchers have successfully developed ELISAs using recombinant gH/gL that demonstrated high sensitivity in detecting EEHV-specific antibodies in elephant sera . The process involves:

  • Optimizing coating conditions for the recombinant protein on ELISA plates

  • Determining appropriate blocking conditions to reduce background

  • Establishing dilution protocols for test sera

  • Selecting suitable detection antibodies (anti-elephant IgG)

  • Validating the assay with known positive and negative samples

These serological tests have revealed that EEHV is far more prevalent than previously thought, with all subadult and adult elephants showing seropositivity in studies across European zoos and Asian elephant range countries . This indicates that recombinant gH-based serological tests can be valuable tools for understanding EEHV epidemiology and infection history in elephant populations.

What are effective methods for validating the functionality of recombinant EEHV1 Glycoprotein H?

Validating the functionality of recombinant EEHV1 Glycoprotein H requires several complementary approaches:

  • Structural validation: Using techniques such as circular dichroism (CD) spectroscopy to confirm proper protein folding and secondary structure.

  • Glycosylation analysis: Mass spectrometry to verify appropriate post-translational modifications.

  • Binding assays: Testing the ability of the recombinant gH (preferably as gH/gL complex) to bind to:

    • Known herpesvirus gH receptors or analogous elephant cell surface molecules

    • Antibodies from EEHV-positive elephant sera

  • Immunological reactivity: Western blotting and ELISA to confirm that the recombinant protein is recognized by antibodies from EEHV-infected elephants. Studies have shown that recombinant gH/gL is strongly recognized by antibodies in elephant sera, confirming its value as an antigen in EEHV-specific diagnostic tests .

  • Functional fusion assays: If possible, cell-cell fusion assays to test whether the recombinant gH/gL can work with gB to facilitate membrane fusion.

How can recombinant EEHV1 Glycoprotein H contribute to vaccine development research?

Recombinant EEHV1 Glycoprotein H has significant potential for EEHV vaccine development research through several approaches:

  • Subunit vaccine candidate: As a key viral envelope protein involved in host cell entry, gH (especially as part of the gH/gL complex) represents a promising subunit vaccine candidate. Antibodies targeting gH could neutralize the virus before it enters host cells.

  • Immunogenicity studies: Recombinant gH can be used to assess immune responses in animal models, helping researchers understand what formulations and adjuvants might produce protective immunity.

  • Correlates of protection: By comparing antibody responses to gH in elephants that survive EEHV infection versus those that succumb to disease, researchers can determine if anti-gH antibodies correlate with protection.

  • Epitope mapping: Recombinant gH can be used to identify specific epitopes that elicit neutralizing antibodies, potentially leading to more focused vaccine designs.

  • Multivalent approaches: Combined with other EEHV glycoproteins like gB, recombinant gH could be used in multivalent vaccine formulations targeting different stages of the viral entry process.

Current observations that elephants with EEHV-HD often have low or non-detectable EEHV-specific antibody titers suggest that vaccines inducing robust anti-gH antibody responses might provide protection against severe disease .

What tissues show EEHV glycoprotein expression during infection?

Studies investigating EEHV tissue tropism have revealed specific patterns of viral glycoprotein expression across elephant tissues. Using antibodies against EEHV glycoproteins (such as gB), immunohistochemical analyses have demonstrated that EEHV antigens are distributed mainly in the epithelial cells of salivary glands, stomach, and intestines . This distribution pattern suggests that these tissues are important sites of viral replication during EEHV infection. Additionally, viral antigens have been detected in endothelial cells of various organs in cases of fatal EEHV-HD, consistent with the virus's endotheliotropic nature. These findings provide crucial insights into the pathogenesis of EEHV infections and highlight potential sites for virus shedding and transmission.

What cell types are primarily infected by EEHV and how can this inform in vitro studies?

EEHV demonstrates specific cellular tropism that has important implications for in vitro studies. Immunofluorescence testing of peripheral blood mononuclear cells (PBMC) from EEHV4-infected calves has shown that the virus is observed predominantly in mononuclear phagocytic cells . Additionally, the virus's endotheliotropic nature means it has a strong affinity for endothelial cells, which become severely affected during fatal cases of EEHV hemorrhagic disease. Epithelial cells of various organs, particularly the salivary glands and intestinal tract, also support EEHV replication .

For in vitro studies, researchers should consider:

  • Using elephant-derived endothelial and epithelial cell cultures when possible

  • Exploring mononuclear phagocytic cells as models for studying EEHV replication

  • Developing co-culture systems that mimic the tissue microenvironments where EEHV naturally replicates

  • Using recombinant glycoproteins including gH to study virus-cell interactions in the absence of infectious virus

Understanding these cellular tropisms helps in designing more relevant experimental systems for studying EEHV pathogenesis and testing antiviral interventions.

What are the potential routes of EEHV transmission based on glycoprotein distribution in tissues?

Based on the distribution of EEHV glycoproteins in infected tissues, several potential routes of EEHV transmission have been identified:

  • Salivary transmission: The detection of EEHV antigens in salivary gland epithelial cells strongly suggests that saliva is a likely source of virus transmission . This is consistent with the common mode of transmission for many other herpesviruses.

  • Fecal-oral transmission: The presence of EEHV antigens in the epithelial cells of the stomach and intestines indicates that intestinal content and feces may contain infectious virus . This suggests a potential fecal-oral route of transmission.

  • Direct contact with blood or tissues: During acute, viremic phases of infection, the virus is present in blood cells (particularly mononuclear phagocytic cells), suggesting that direct blood contact could potentially transmit the virus .

These findings have important implications for management practices in captive elephant populations and provide guidance for developing preventive measures to reduce EEHV transmission risk. Monitoring of saliva and fecal samples could potentially be used for early detection of viral shedding in elephant herds.

How does Glycoprotein H compare with other EEHV envelope glycoproteins like Glycoprotein B?

EEHV Glycoprotein H and Glycoprotein B serve complementary but distinct roles in the viral entry process. A comparative analysis reveals:

FeatureGlycoprotein H (gH)Glycoprotein B (gB)
Size737 amino acids 836 amino acids
FunctionForms complex with gL; activates gB; may function in receptor binding Forms homotrimer; fusogenic protein that mediates membrane fusion
Sequence conservation31-34% nucleotide divergence between EEHV genotypes 21-26% nucleotide divergence between EEHV genotypes
Protein divergence~40% amino acid divergence between EEHV genotypes 14-18% amino acid divergence between EEHV genotypes
Complex formationFunctions as heterodimer with gL Functions as homotrimer
ImmunogenicityImportant target of herpesvirus-specific immune response Important target of herpesvirus-specific immune response

What is known about the genetic diversity of EEHV1 Glycoprotein H across different virus isolates?

The genetic diversity of EEHV1 Glycoprotein H across different virus isolates reveals important evolutionary patterns within this viral family. Genomic analyses have shown:

This genetic diversity has implications for diagnostic test development, as assays targeting highly variable regions might fail to detect all EEHV variants. It also suggests that vaccine development might need to account for this variation to provide broad protection.

What are the most pressing research questions regarding EEHV1 Glycoprotein H?

Several critical research questions regarding EEHV1 Glycoprotein H remain to be addressed:

  • Structural characterization: What is the three-dimensional structure of EEHV1 gH, both alone and in complex with gL? How does this structure compare to other herpesvirus gH proteins?

  • Receptor interactions: What cellular receptors does the EEHV1 gH/gL complex interact with during viral entry? Are these interactions conserved across elephant species and EEHV genotypes?

  • Neutralizing epitopes: Which epitopes on EEHV1 gH are targeted by neutralizing antibodies? Could these be exploited for vaccine development?

  • Species specificity: What molecular features of EEHV1 gH contribute to the virus's host specificity for elephants? How do these features differ between Asian and African elephant-specific EEHV variants?

  • Functional interactions: How do gH/gL and gB work together at the molecular level to facilitate membrane fusion during EEHV entry?

  • Therapeutic targeting: Could small molecule inhibitors or peptides targeting gH function be developed as potential therapeutics for EEHV infection?

Addressing these questions would significantly advance our understanding of EEHV pathogenesis and inform the development of vaccines and therapies.

What novel technologies could advance research on EEHV1 Glycoprotein H?

Several cutting-edge technologies could accelerate research on EEHV1 Glycoprotein H:

  • Cryo-electron microscopy: This could reveal the detailed structure of the gH/gL complex and its interactions with gB during the fusion process, providing insights that could inform therapeutic design.

  • Single-cell RNA sequencing: Applied to infected elephant tissues, this could identify which cell types express receptors for gH/gL and reveal cellular responses to viral glycoprotein expression.

  • CRISPR/Cas9 genome editing: Could be used to modify putative receptor genes in elephant cell lines to confirm their roles in EEHV entry.

  • Organoid models: Developing elephant-derived organoids (particularly from endothelial or epithelial tissues) could provide more relevant systems for studying EEHV infection dynamics.

  • Protein-protein interaction mapping: Techniques like proximity labeling could identify cellular proteins that interact with gH during the viral life cycle.

  • Nanobody development: Camelid-derived single-domain antibodies (nanobodies) against gH/gL could serve as both research tools and potential therapeutics.

  • Artificial intelligence for structure prediction: Tools like AlphaFold could predict structural features of gH/gL to guide functional studies when experimental structures are unavailable.

These technologies could overcome many of the challenges in studying EEHV, including the difficulty of culturing the virus in vitro and the limited availability of elephant tissue samples.

How could improved understanding of EEHV1 Glycoprotein H impact elephant conservation efforts?

Enhanced knowledge of EEHV1 Glycoprotein H could significantly impact elephant conservation through several pathways:

  • Improved diagnostics: Better understanding of gH antigenicity could lead to more sensitive and specific diagnostic tests, enabling earlier detection of EEHV infections before clinical signs appear. The development of gH-based ELISAs has already revealed that EEHV is far more widespread than previously thought .

  • Vaccine development: As a key viral envelope protein, gH represents a promising target for vaccine strategies. Effective vaccines could protect vulnerable young elephants from fatal EEHV-HD.

  • Risk assessment: Understanding the antibody responses to gH in different elephant populations could help identify high-risk groups for targeted monitoring and intervention.

  • Epidemiological insights: The finding that all adult elephants appear to be EEHV-seropositive suggests that surviving initial infection may confer protection against subsequent disease . This knowledge can inform management strategies for captive breeding programs.

  • Antiviral therapies: Detailed knowledge of gH function could lead to the development of targeted antiviral therapies that disrupt the viral entry process.

  • Transmission prevention: Understanding the role of gH in different tissues helps identify likely routes of transmission (e.g., via saliva or feces) , informing management practices to reduce transmission risk in captive populations.

By combining improved diagnostics, potential vaccines, and better management strategies based on sound scientific understanding of EEHV1 gH, the devastating impact of EEHV on elephant populations could be significantly reduced.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.