Recombinant Elephantid herpesvirus 1 Glycoprotein N

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
gN; Envelope glycoprotein N
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-171
Protein Length
full length protein
Species
Elephantid herpesvirus 1 (isolate Asian elephant/Berlin/Kiba/1998) (EIHV-1) (Elephant endotheliotropic herpesvirus)
Target Names
gN
Target Protein Sequence
MARINSNSGTAVLSRGAAVPAARRPASGTSASKISKLSSTGPPNAPWSKSLTIFKTFISV YLGQAACLAASSRISSRCIVCIRSTLFLTLFALNVAQEFVFGATPAPTVKTDLNIRDFSK SSCSALKYRIYVSSFVSVLNIILYVLLFLASVVYIRYLCHQSITTETVKDY
Uniprot No.

Target Background

Function

Envelope glycoprotein essential for proper gM maturation and modulation of its membrane fusion activity. It also plays a critical role in virion morphogenesis.

Protein Families
Herpesviridae glycoprotein N family
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host membrane; Single-pass type I membrane protein. Host Golgi apparatus, host trans-Golgi network.

Q&A

What is Elephantid herpesvirus 1 and its significance to elephant health?

Elephantid herpesvirus 1 (EEHV1) belongs to a family of novel endotheliotropic herpesviruses assigned to the genus Proboscivirus that have been identified as the cause of fatal hemorrhagic disease in at least 70 young Asian elephants worldwide . EEHV1 is the most common genotype associated with these fatalities, primarily affecting juvenile animals up to the age of four years . The virus cannot be grown in cell culture, which has made its study challenging .

EEHV1 exists in at least two major subgroups referred to as EEHV1A and EEHV1B . The genomes of these viruses are approximately 180-206 kb in size and contain around 115-120 predicted protein-coding genes . These viruses pose a significant threat to both captive and wild Asian elephant populations, affecting approximately 20% of all captive Asian elephant calves born in zoos in the United States and Europe since 1980 .

What expression systems are optimal for producing recombinant EEHV1 Glycoprotein N?

Multiple expression systems have been employed for producing recombinant EEHV1 gN, each with distinct advantages:

Bacterial Expression (E. coli):
Recombinant EEHV1 gN has been successfully expressed in E. coli as a full-length protein (1-171 amino acids) with either an N-terminal His-tag or with His-tag/tag-free options . This system typically yields high protein quantities but may lack post-translational modifications.

Mammalian Expression Systems:
While not specifically documented for gN in the search results, other EEHV glycoproteins such as gB and gH/gL have been successfully produced in mammalian cells . For these proteins, the coding sequences were fused to the Gaussia luciferase signal sequence and a C-terminal StrepTag or HisTag, which facilitated secretion and purification . This approach likely preserves native conformation and post-translational modifications better than bacterial systems.

For researchers requiring properly folded and glycosylated proteins for functional studies, mammalian expression systems are recommended despite potentially lower yields compared to bacterial systems.

What purification strategies yield the highest quality recombinant EEHV1 Glycoprotein N?

Based on documented purification protocols for recombinant EEHV1 glycoproteins, the following strategies are recommended:

For His-tagged gN expressed in E. coli:

  • Affinity purification using nickel or cobalt resins

  • Protein is typically lyophilized after purification

  • Storage in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Reconstitution in deionized sterile water to 0.1-1.0 mg/mL

  • Addition of glycerol (5-50%, with 50% as default) for long-term storage at -20°C/-80°C

For StrepTag-fusion proteins:

  • For secreted glycoproteins, clear media of debris by low-speed centrifugation

  • Purify using Strep-Tactin Sepharose beads

  • Quantify by densitometry of GelCode Blue-stained protein gels against BSA standards

  • Image and analyze using an Odyssey imaging system

Purity assessments via SDS-PAGE typically show >90% purity for commercially available recombinant gN preparations .

How can recombinant EEHV1 Glycoprotein N be used in diagnostic assay development?

Recombinant EEHV1 gN offers multiple applications for diagnostic assay development:

ELISA-Based Detection:
The biological activity of recombinant EEHV1 gN has been determined by its binding ability in functional ELISA assays . For ELISA development:

  • Optimize coating concentration through antigen dilution tests (e.g., 40–1.25 ng/well) using known positive and negative elephant sera

  • For comparing multiple EEHV subspecies variants, establish coating ratios using the formula:
    (ng protein coated for EEHVx to obtain an OD of y)/(ng protein coated for EEHV1A to obtain an OD of y)

  • Use recombinant protein A/G-HRP (0.5 µg/mL) as the secondary conjugate to detect elephant antibodies

Subspecies Differentiation:
While gN-specific cross-reactivity data is not directly provided in the search results, data from other EEHV glycoproteins suggests that careful epitope selection could enable subspecies-specific diagnostics. For example, while gB shows high cross-reactivity between subspecies, gH/gL antibody levels are less correlated and allow differentiation between subspecies .

What role does Glycoprotein N play in EEHV1 pathogenesis studies?

Recombinant EEHV1 gN can contribute to pathogenesis studies in several ways:

  • Target Cell Identification: Since gN is an envelope glycoprotein involved in viral entry, it can be used to study cell tropism. EEHV has been found to target "epithelia of the alimentary tract and salivary glands, endothelia and smooth muscle cells, and monocytic lineage cells" .

  • Protein-Protein Interactions: As gN interacts with gM , studying this interaction can provide insights into viral assembly mechanisms. Co-expression and co-immunoprecipitation studies with recombinant gN and gM could elucidate specific molecular details of their interaction.

  • Immune Response Analysis: Understanding antibody responses to gN could help explain protection or susceptibility to EEHV-associated disease. Evidence from other glycoproteins indicates that antibody levels against certain viral proteins correlate with protection; for example, "all EEHV-HD fatalities (n = 23) had low antibody levels against gH/gL of the subspecies causing disease" .

  • Structural-Functional Relationships: Structure-function studies using recombinant gN variants could identify domains critical for virion morphogenesis and interaction with host or viral factors.

What are validated methods for assessing recombinant EEHV1 Glycoprotein N functionality?

Several approaches have been successfully employed to validate recombinant EEHV glycoprotein functionality that can be applied to gN:

Binding Assays:

  • Functional ELISA to verify binding to antibodies from recovered elephants

  • Western blotting using tag-specific antibodies (e.g., HRP-conjugated monoclonal anti-StrepTag) and detection by enhanced chemiluminescence (ECL)

Quality Control Metrics:

  • Purity determination by SDS-PAGE (>90% purity is standard)

  • Protein quantification through densitometry against BSA standards

Functional Verification:

  • Given gN's role in gM maturation and modulation , binding studies with recombinant gM could verify functional activity

  • Comparison of antibody recognition patterns between naturally infected animals and those immunized with recombinant protein

Specificity Assessment:

  • Testing against panels of sera from EEHV-positive and negative elephants

  • Cross-reactivity testing with antibodies against different EEHV subspecies

How can epitope mapping studies be designed for EEHV1 Glycoprotein N?

Effective epitope mapping for EEHV1 gN should employ multiple complementary approaches:

Linear Epitope Identification:

  • Generate overlapping synthetic peptides (typically 15-20 amino acids with 5-10 amino acid overlap) spanning the 171 amino acid sequence of EEHV1 gN

  • Screen peptides against sera from EEHV-infected elephants using ELISA or peptide arrays

  • Apply computational prediction tools to identify regions likely under positive selection, similar to the approach used for gB where "An extra-cytoplasmic region of 153 amino acids was predicted to be under positive selection"

Conformational Epitope Mapping:

  • Express truncated variants of gN to map larger functional domains

  • Introduce site-directed mutations at predicted surface-exposed residues

  • Compare antibody binding to gN expressed in mammalian versus bacterial systems to identify glycosylation-dependent epitopes

Comparative Approaches:

  • Compare epitope recognition patterns between elephants infected with different EEHV subspecies

  • Conduct competition assays between different gN variants or between gN and other envelope glycoproteins

  • Perform cross-neutralization studies if surrogate neutralization assays can be developed

What insights have been gained from serological studies using EEHV recombinant glycoproteins?

Serological studies using EEHV recombinant glycoproteins have yielded several important insights:

Prevalence and Exposure:

  • All subadult (between 5 and 15 years of age) and adult elephants (≥15 years of age) living under human care in either European zoos (n = 34) or an Asian elephant range country (Laos, n = 69) were seropositive for EEHV , indicating universal exposure in adult populations.

Protection Correlates:

  • All documented fatal EEHV-HD cases had low or non-detectable EEHV-specific antibody titers, suggesting these animals experienced primary infections .

  • While high gB-specific antibody levels were detected in some EEHV-HD fatalities, all fatalities (n = 23) had low antibody levels against gH/gL of the subspecies causing disease , indicating that gH/gL-specific antibodies may better correlate with protection.

Cross-reactivity Patterns:

  • Antibody levels measured against gB of different EEHV subspecies correlated strongly with one another, suggesting high cross-reactivity

  • In contrast, antibody levels against gH/gL of different subspecies were far less correlated, allowing differentiation between subspecies

Diagnostic Implications:

  • These findings suggest that (sub)species-specific gH/gL ELISAs can identify animals at risk of EEHV-HD when infected with a particular EEHV subspecies, even if they have been previously infected with different EEHV subspecies

What are the major obstacles in working with recombinant EEHV glycoproteins?

Researchers face several significant challenges when working with recombinant EEHV glycoproteins, including gN:

Expression and Folding:

  • Properly folded glycoproteins often require mammalian expression systems for correct post-translational modifications

  • Bacterial expression (E. coli) may yield higher quantities but potentially with improper folding or lack of glycosylation

Assay Standardization:

  • Ensuring equivalent antigen coating in ELISA requires careful calibration, especially when comparing different glycoprotein variants

  • Search result describes determining coating ratios using tag-specific antibodies to standardize protein amounts across different variants

Cross-reactivity Management:

  • Distinguishing between antibodies against different EEHV subspecies can be challenging due to cross-reactivity

  • This is particularly evident with gB, which shows high cross-reactivity between subspecies, whereas gH/gL exhibits more subspecies-specific reactivity patterns

Validation Limitations:

  • The inability to culture EEHV limits validation options for recombinant proteins

  • Researchers must rely on sera from naturally infected elephants for validation, which may contain antibodies to multiple viral proteins

How do antibody responses to different EEHV1 glycoproteins compare in diagnostic applications?

Different EEHV1 glycoproteins elicit varying antibody responses with distinct diagnostic utilities:

gB Responses:

  • gB is an immunodominant antigen recognized by antibodies elicited against multiple EEHV subspecies

  • Antibody levels measured against gB of different subspecies correlate strongly, indicating high cross-reactivity

  • While high gB-specific antibody levels were detected in some EEHV-HD fatalities, this was not predictive of protection

gH/gL Responses:

  • Antibody levels against gH/gL of different subspecies show less correlation than gB

  • Low or non-detectable antibody levels against the specific gH/gL subspecies causing infection were observed in all EEHV-HD fatalities (n = 23)

  • This indicates that (sub)species-specific gH/gL ELISAs may better identify animals at risk of EEHV-HD

Comparative Data:
The following table summarizes key differences between gB and gH/gL antibody responses:

FeaturegB AntibodiesgH/gL Antibodies
Cross-reactivity between subspeciesHighLow
Correlation with protectionPoorStrong
Utility in identifying at-risk animalsLimitedHigh
Presence in EEHV-HD fatalitiesMay be presentAlways low/undetectable for causative subspecies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.