Recombinant Elephas maximus Alpha-2B adrenergic receptor (ADRA2B)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Elephas maximus Alpha-2B Adrenergic Receptor (ADRA2B)

Recombinant Elephas maximus Alpha-2B adrenergic receptor (ADRA2B) is a synthetic protein derived from the Indian elephant (Elephas maximus) and expressed in E. coli. This full-length receptor (1–384 amino acids) is N-terminally His-tagged and purified to >90% homogeneity, as verified by SDS-PAGE . ADRA2B belongs to the α2-adrenergic receptor family, which regulates neurotransmitter release and modulates physiological responses to norepinephrine. Its recombinant form is critical for studying receptor-ligand interactions, signaling mechanisms, and therapeutic applications .

Role in Neurological and Physiological Processes

ADRA2B modulates neurotransmitter release in the sympathetic nervous system and CNS. Key findings include:

  1. Emotional Memory and PTSD: A deletion variant of ADRA2B enhances amygdala activity during emotional memory formation, predisposing individuals to traumatic memory retention .

  2. Hypertension: ADRA2B interacts with spinophilin to mediate hypertensive responses, suggesting a therapeutic target for blood pressure regulation .

  3. Inflammation: α2B antagonists show limited efficacy in intestinal inflammation models compared to α2A subtypes .

Genetic Polymorphisms

A polymorphic variant of ADRA2B reduces receptor desensitization, potentially contributing to obesity by altering metabolic rates .

Binding Pocket Dynamics

ADRA2B’s orthosteric pocket differs from β-adrenergic receptors in critical residues:

ResidueRoleComparison to β-Adrenoceptors
F412Binds imidazoline drugs (e.g., dexmedetomidine) via hydrophobic interactionsReplaced by smaller residues in β2AR
Y391Forms hydrogen bonds with ligand phenyl ringsConserved across α2 subtypes
D92Ionic interaction with ligand amino groupsCritical for agonist binding

Cryo-EM studies reveal that α2BAR activation involves outward movement of TM6 and inward TM7 displacement, a hallmark of GPCR activation .

Experimental Protocols

  1. SDS-PAGE: Validates protein purity and integrity .

  2. Antibody Development: Monoclonal antibodies (e.g., MAB10324) enable detection in transfected HEK293 cells .

  3. Functional Assays:

    • G-Protein Coupling: Measures GoA activation (e.g., with norepinephrine) .

    • Ligand Screening: Tests selectivity of imidazolines (e.g., brimonidine) versus β-agonists .

Therapeutic Implications

ADRA2B is implicated in:

  • Psychiatric Disorders: Modulation of compulsivity and sensorimotor gating in schizophrenia/ADHD .

  • Hypertension: Spinophilin-dependent signaling pathways .

Table 1: Critical Residues in ADRA2B Ligand Binding

PositionResidueInteractionLigand Specificity
3.32DIonic bond with ligand amino groupsAgonists (e.g., norepinephrine)
5.42SHydrogen bonding with ligand hydroxylImidazolines (e.g., dexmedetomidine)
6.55YAromatic stacking with ligand phenylAgonists
7.43YHydrogen bonding with ligand imidazoleImidazolines

Table 2: ADRA2B-Related Clinical and Preclinical Findings

ConditionMechanismEvidence
PTSDEnhanced amygdala activity during emotional memory encoding Functional MRI studies in humans
HypertensionSpinophilin-mediated vasoconstriction Knockout mouse models
ObesityReduced desensitization in polymorphic variants Genetic association studies

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If a specific tag type is required, please inform us, and we will prioritize its incorporation.
Synonyms
ADRA2B; Alpha-2B adrenergic receptor; Alpha-2B adrenoreceptor; Alpha-2B adrenoceptor; Alpha-2BAR; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-384
Protein Length
full length protein
Species
Elephas maximus (Indian elephant)
Target Names
Target Protein Sequence
AIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANE LLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALQYNSKRTPRRIKCVI LTVWLIAAAISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILSSSIGSFFAPCLIMILVYL RIYLIAKRSNRRGPRAKGAPREGEPKQPHPLPAGPSALANSPTLASSLAVTGEANGHSEP PGEKERETPEDPGTLTLPPSWPVLPNSGQGQKEGVCGASPEEEEECGSPAVPASPALACS PPLQQPKGSRVLATLRGQVLLGRGVGTAGGQWWRRRAQLTREKRFTFVLAVVIGVFVLCW FPFFFSYSLGAICPQHCKVPHGLF
Uniprot No.

Target Background

Function
Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase via G protein coupling.
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRA2B sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is ADRA2B and what are its primary functions in cellular signaling?

The Alpha-2B adrenergic receptor (ADRA2B) is a G-protein coupled receptor containing seven transmembrane domains. In humans, it is encoded by the ADRA2B gene and functions as a subtype of the adrenergic receptor family found across multiple mammalian species . At the cellular level, ADRA2B plays an essential role in regulating neurotransmitter release from sympathetic nerves and adrenergic neurons in the central nervous system .

The receptor mediates its effects through G-protein coupled signaling pathways, particularly through inhibitory G proteins that suppress adenylyl cyclase activity. ADRA2B has been observed to associate with eIF-2B, a guanine nucleotide exchange protein involved in translational regulation . This interaction suggests potential roles beyond classical adrenergic signaling, potentially influencing protein synthesis pathways.

How does the structural composition of Elephas maximus ADRA2B compare to human ADRA2B?

The Elephas maximus (Indian elephant) ADRA2B protein consists of 384 amino acids, with significant sequence homology to human ADRA2B which is 450 amino acids in length . Analysis of the protein sequences reveals:

FeatureElephas maximus ADRA2BHuman ADRA2B
Length (aa)384450
Transmembrane domains77
UniProt IDO19014P18089
N-terminal regionShorter compared to humanExtended N-terminus
Conserved domainsMaintains key signaling motifsReference sequence

The elephant ADRA2B maintains the essential structural features required for G-protein coupling and ligand binding, particularly in the transmembrane regions which show high conservation . The primary sequence differences appear in the intracellular loops and C-terminal regions, which may suggest species-specific regulation or signaling characteristics.

What are the key differences between alpha-2 adrenergic receptor subtypes?

Alpha-2 adrenergic receptors are classified into three highly homologous subtypes: α2A, α2B, and α2C . These subtypes share structural similarities but display distinct pharmacological profiles and tissue distribution patterns:

SubtypeSelective Agonists/AntagonistsTissue DistributionFunctional Characteristics
α2AOxymetazoline (selective)Human platelets, HT29 cell line, human cerebral cortexHigher affinity for certain ligands like oxymetazoline
α2BPrazosin, ARC-239 (100-fold selective), chlorpromazine (18-fold selective)Neonatal rat lung, NG108-15 cell lineHigher affinity for prazosin; involved in vascular smooth muscle contraction
α2CNon-specific between subtypes A and BVarious tissuesIntermediate pharmacological profile

The subtypes can be distinguished through radioligand binding studies using selective compounds. When comparing drug affinities between α2A and α2B tissues, correlation coefficients range from r=0.77 to -0.87, indicating distinct pharmacological profiles . In contrast, comparisons within the same subtype show high correlations (r=0.97 to 0.99) .

What expression systems are optimal for producing functional recombinant Elephas maximus ADRA2B?

  • E. coli expression system:

    • Advantages: High protein yield, cost-effective, rapid growth

    • Limitations: Lack of post-translational modifications, potential for inclusion body formation, challenges with membrane protein folding

    • Optimization: Use of specialized E. coli strains (e.g., C41/C43), lower induction temperatures (16-25°C), and specific detergents for extraction

  • Mammalian expression systems (though not mentioned in the search results, relevant for functional studies):

    • Advantages: Native-like post-translational modifications, proper folding of transmembrane domains

    • Limitations: Higher cost, lower yield, longer production time

    • Applications: Recommended for functional studies requiring properly folded receptors

  • Insect cell systems (baculovirus):

    • Advantages: Moderate yields, some post-translational modifications

    • Limitations: Different glycosylation patterns compared to mammalian cells

    • Applications: Compromise between bacterial and mammalian systems

For structural studies requiring large quantities of protein, E. coli remains the predominant system as demonstrated by the commercial production of His-tagged Elephas maximus ADRA2B .

What methodologies can effectively assess the functional integrity of recombinant ADRA2B?

To verify that recombinant ADRA2B maintains its native functionality, researchers should implement multiple complementary approaches:

  • Ligand binding assays:

    • Radioligand competition assays using [³H]yohimbine or [³H]rauwolscine as demonstrated in alpha-2 receptor subtype characterization studies

    • Saturation binding assays to determine receptor density (Bmax) and binding affinity (Kd)

    • Competition binding with subtype-selective compounds such as oxymetazoline, prazosin, and ARC-239 to confirm pharmacological profile

  • G-protein coupling assays:

    • GTPγS binding assays to measure receptor-induced G-protein activation

    • BRET/FRET-based assays to monitor receptor-G protein interactions in real-time

  • Downstream signaling assays:

    • Measurement of cAMP levels to confirm inhibition of adenylyl cyclase

    • Calcium mobilization assays to assess Gq-coupled responses (if applicable)

    • ERK phosphorylation assays to evaluate MAPK pathway activation

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure content

    • Limited proteolysis followed by mass spectrometry to confirm correct folding

    • Thermal stability assays to assess protein stability

How do storage conditions affect the stability and functionality of recombinant Elephas maximus ADRA2B?

Optimal storage conditions are critical for maintaining the functional integrity of recombinant ADRA2B. Based on the provided information:

  • Temperature considerations:

    • Long-term storage: -20°C to -80°C is recommended for extended preservation

    • Working aliquots: Can be stored at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

  • Buffer composition:

    • Tris/PBS-based buffer with 6% trehalose (pH 8.0) has been successfully employed

    • Addition of glycerol (5-50% final concentration) is recommended for long-term storage, with 50% being a standard concentration

  • Storage format:

    • Lyophilized powder format provides extended shelf life (approximately 12 months at -20°C/-80°C)

    • Liquid formulations have shorter shelf lives (approximately 6 months at -20°C/-80°C)

  • Reconstitution protocol:

    • Brief centrifugation prior to opening is recommended to bring contents to the bottom of the vial

    • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is advised

    • After reconstitution, aliquoting with glycerol addition is recommended to prevent multiple freeze-thaw cycles

The shelf life is influenced by multiple factors including storage state, buffer composition, storage temperature, and the intrinsic stability of the protein itself .

What strategies can resolve challenges in purifying transmembrane proteins like ADRA2B?

Purification of transmembrane proteins presents unique challenges due to their hydrophobic nature and structural complexity. For ADRA2B, researchers can employ the following strategies:

  • Affinity tag selection and placement:

    • N-terminal His-tagging has been successfully implemented in commercial preparations of Elephas maximus ADRA2B

    • His-tag purification using immobilized metal affinity chromatography (IMAC) provides efficient one-step purification

    • Alternative tags (e.g., FLAG, STREP) may be considered for specific applications requiring different elution conditions

  • Detergent selection and optimization:

    • Initial screening of multiple detergent classes (maltosides, glucosides, cholate derivatives)

    • Assessment of detergent impact on protein stability using thermal shift assays

    • Consideration of detergent exchange during purification to optimize stability

  • Membrane fraction preparation:

    • Gentle cell lysis methods to preserve native protein conformation

    • Differential centrifugation to isolate membrane fractions

    • Solubilization optimization through detergent:protein ratio screening

  • Chromatography sequence:

    • IMAC as primary capture step for His-tagged ADRA2B

    • Size exclusion chromatography to separate protein aggregates and evaluate oligomeric state

    • Ion exchange chromatography as a polishing step if higher purity is required

  • Quality control assessments:

    • SDS-PAGE to verify purity (>90% purity has been achieved in commercial preparations)

    • Western blotting with anti-His antibodies or ADRA2B-specific antibodies

    • Mass spectrometry to confirm protein identity and integrity

How can researchers design comparative studies between human and elephant ADRA2B to elucidate evolutionary adaptations?

Comparative studies between human and Elephas maximus ADRA2B can provide valuable insights into evolutionary adaptations of adrenergic signaling. A comprehensive research approach should include:

  • Sequence and structural analysis:

    • Multiple sequence alignment of ADRA2B across diverse mammalian species

    • Homology modeling of elephant ADRA2B based on available GPCR crystal structures

    • Identification of conserved functional domains versus species-specific variations

    • Analysis of selection pressure on different protein regions (dN/dS ratio)

  • Functional comparative studies:

    • Parallel expression of human and elephant ADRA2B under identical conditions

    • Ligand binding profiles using a panel of adrenergic compounds

    • G-protein coupling efficiency measurements

    • Signaling cascade activation comparisons

    • Agonist-induced receptor internalization and trafficking studies

  • Physiological context integration:

    • Correlation of receptor characteristics with species-specific physiological traits

    • Investigation of potential adaptations related to elephant-specific environmental pressures

    • Analysis of receptor expression patterns in comparable tissues across species

  • Experimental design considerations:

    • Use of matched expression systems (same cell line for both receptors)

    • Identical tagging strategies to eliminate tag-related variations

    • Parallel purification protocols

    • Blinded analysis of functional data to prevent bias

What disease associations have been identified for ADRA2B variants and how might this inform therapeutic development?

Several clinical conditions have been associated with ADRA2B variants, suggesting potential therapeutic targets:

  • Neurological disorders:

    • Epilepsy, Familial Adult Myoclonic, and Benign Adult Familial Myoclonic Epilepsy have been associated with ADRA2B

    • These associations suggest potential roles in neuronal excitability regulation

  • Emotional processing alterations:

    • A deletion variant of ADRA2B has been linked to enhanced emotional memory

    • This variant predisposes individuals to focus more on negative aspects of situations

    • Potential implications for anxiety disorders, PTSD, and depression

  • Cardiovascular system involvement:

    • ADRA2B participates in pathways responding to elevated platelet cytosolic Ca²⁺

    • Possible role in thrombotic disorders and vascular tone regulation

  • Research approach for therapeutic development:

    • Comparative pharmacology studies using subtype-selective compounds

    • Structure-based drug design targeting specific ADRA2B conformations

    • Development of allosteric modulators to fine-tune receptor function

    • Analysis of signaling bias to separate therapeutic effects from side effects

How can the pharmacological profile of ADRA2B subtypes be leveraged for selective drug development?

Understanding the distinct pharmacological profiles of ADRA2B and other adrenergic receptor subtypes provides opportunities for developing selective therapeutic agents:

  • Subtype-selective compounds:

    • Prazosin demonstrates selectivity for α2B receptors over α2A receptors

    • ARC-239 shows approximately 100-fold selectivity for α2B subtypes

    • Chlorpromazine and 7-hydroxychlorpromazine exhibit 18-fold and 17-fold selectivity, respectively, for α2B subtypes

    • Oxymetazoline displays selectivity for α2A receptors

  • Structure-activity relationship studies:

    • Systematic modification of lead compounds to enhance subtype selectivity

    • Identification of chemical scaffolds with inherent subtype preferences

    • Hybrid molecule design combining binding elements from multiple selective ligands

  • Rational drug design approaches:

    • Homology modeling of receptor subtypes to identify structural differences

    • Molecular docking studies to predict selective interactions

    • Fragment-based drug discovery targeting subtype-specific binding pockets

  • Functional selectivity exploitation:

    • Development of biased ligands that selectively activate beneficial signaling pathways

    • Design of partial agonists with subtype-specific efficacy profiles

    • Creation of selective allosteric modulators that fine-tune receptor response

What analytical techniques are most effective for characterizing ADRA2B receptor-ligand interactions?

Multiple analytical approaches can be employed to characterize ADRA2B-ligand interactions with varying degrees of resolution and information content:

  • Radioligand binding assays:

    • Competition binding using [³H]yohimbine or [³H]rauwolscine as demonstrated in subtype characterization studies

    • Saturation binding to determine affinity constants

    • Kinetic binding studies to assess association and dissociation rates

    • Assay limitations: requires radioactive materials, limited to binding site occupancy information

  • Advanced biophysical methods:

    • Surface plasmon resonance (SPR) for label-free, real-time binding kinetics

    • Isothermal titration calorimetry (ITC) to obtain thermodynamic parameters

    • Microscale thermophoresis (MST) for solution-based binding measurements

    • Fluorescence-based techniques (FRET, fluorescence polarization) for high-throughput screening

  • Structural biology approaches:

    • X-ray crystallography of ligand-bound ADRA2B (challenging for GPCRs)

    • Cryo-electron microscopy for structural determination of receptor-ligand complexes

    • NMR spectroscopy for dynamic binding information

    • Hydrogen-deuterium exchange mass spectrometry for conformational changes upon binding

  • Computational methods:

    • Molecular dynamics simulations to model ligand binding and receptor conformational changes

    • Free energy perturbation calculations to estimate binding affinities

    • Pharmacophore modeling to identify key interaction features

    • Virtual screening to identify novel ligands with predicted subtype selectivity

How can researchers effectively differentiate between alpha-2 receptor subtypes in experimental systems?

Distinguishing between alpha-2 receptor subtypes requires careful experimental design and implementation of multiple complementary approaches:

  • Pharmacological profiling:

    • Use of subtype-selective compounds in competition binding assays

    • Correlation analysis of drug affinities across multiple compounds

    • Development of "fingerprint" profiles using a diverse ligand panel

    • Key selective compounds: prazosin and ARC-239 (α2B-selective), oxymetazoline (α2A-selective)

  • Molecular approaches:

    • Subtype-specific antibodies for immunological detection

    • RT-PCR with subtype-specific primers to quantify mRNA expression

    • CRISPR/Cas9-mediated knockout of specific subtypes

    • Heterologous expression of individual subtypes in receptor-null backgrounds

  • Tissue/cell selection:

    • Use of tissues with predominant expression of specific subtypes:

      • α2A subtypes: human platelets, HT29 cell line, human cerebral cortex

      • α2B subtypes: neonatal rat lung, NG108-15 cell line

  • Functional discrimination:

    • Analysis of subtype-specific signaling patterns

    • Receptor internalization and trafficking characteristics

    • Measurement of subtype-specific physiological responses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.