Recombinant Elephas maximus ATP synthase subunit a (MT-ATP6)

Shipped with Ice Packs
In Stock

Description

Introduction to ATP Synthase and MT-ATP6

ATP synthase is a pivotal enzyme in cellular energy metabolism, catalyzing ATP production via oxidative phosphorylation . The MT-ATP6 gene encodes subunit a of the membrane-embedded F<sub>O</sub> sector, which facilitates proton translocation across the mitochondrial inner membrane to drive ATP synthesis . Mutations in MT-ATP6 are linked to mitochondrial disorders such as neuropathy, ataxia, and retinitis pigmentosa (NARP) and Leigh syndrome .

Recombinant Elephas maximus ATP Synthase Subunit a (MT-ATP6)

Recombinant Elephas maximus (Indian elephant) ATP synthase subunit a (MT-ATP6) is a bacterially expressed protein used for structural, functional, and diagnostic studies. Key specifications include:

ParameterDetails
UniProt IDQ2I3G9
SpeciesElephas maximus
Expression SystemE. coli
TagDetermined during production (N- or C-terminal)
Sequence1-222 amino acids (Full-length)
Storage-20°C in Tris-based buffer with 50% glycerol
PurityOptimized for ELISA and structural studies
Sequence FeaturesContains conserved proton channel domains and transmembrane helices

This recombinant protein enables investigations into the evolutionary conservation of ATP synthase mechanisms across species .

Production and Purification

  • Expression: Optimized in E. coli for high yield .

  • Purification: Affinity chromatography followed by gel filtration .

  • Reconstitution: Requires addition of 5–50% glycerol for long-term stability .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
MT-ATP6; ATP6; ATPASE6; MTATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-222
Protein Length
full length protein
Species
Elephas maximus (Indian elephant)
Target Names
Target Protein Sequence
MNEELSAFFDVPVGTMMLAIAFPAILLPTPNRLITNRWITIQQWLIQLIMKQLLSIHNMK GLSWSLMLITLTLFIGLTNLLGLLPYSFAPTTQLTVNLSMAIPLWTGTVVLGFRYKTKIS LAHLLPQGTPTFLIPMIIIIETISLLIRPITLAVRLTANITAGHLLIHLTGSAALTLLSV HLMTITVTFITVVMLTILELAVALIQAYVFALLISLYLHESA
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) synthesizes ATP from ADP using a proton gradient across the membrane, generated by the respiratory chain's electron transport complexes. F-type ATPases comprise two domains: the extramembranous catalytic core, F1, and the membrane proton channel, F0, connected by a central and peripheral stalk. ATP synthesis within F1's catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. A key component of the proton channel, this subunit may directly participate in proton translocation across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of ATP synthase subunit a in Elephas maximus?

ATP synthase subunit a (MT-ATP6) in Elephas maximus is a hydrophobic, membrane-embedded protein component of the F₀ portion of mitochondrial ATP synthase. This subunit forms an essential part of the proton channel that facilitates the flow of hydrogen ions across the inner mitochondrial membrane. Similar to bacterial ATP synthases, the subunit a in mitochondrial ATP synthase contains multiple transmembrane α-helices that create the architecture necessary for proton translocation . The subunit works in concert with the c-ring to convert the energy from the proton gradient into mechanical rotation, which ultimately drives ATP synthesis in the F₁ portion of the complex.

ATP synthase subunit a specifically contributes to the formation of two offset half-channels that allow protons to enter from the intermembrane space and exit to the mitochondrial matrix. The key functional residues in this subunit include a conserved arginine (equivalent to Arg169 in Bacillus PS3), which is critical for preventing proton leakage between the half-channels and for facilitating proton transfer to and from the c-ring . Understanding the specific structural characteristics of elephant MT-ATP6 can provide insights into mitochondrial function in this species and potential adaptations related to the animal's high energy requirements.

How does elephant MT-ATP6 differ from ATP synthase subunit a in other mammals?

Elephant MT-ATP6 shares structural homology with ATP synthase subunit a from other mammals, but contains species-specific amino acid variations that may reflect evolutionary adaptations to the unique physiological demands of these large mammals. When comparing elephant MT-ATP6 with other mammalian homologs, researchers should focus on analyzing conservation patterns in key functional regions, particularly those involved in proton translocation.

The most critical regions to examine include the transmembrane helices that form the proton half-channels and the amino acid residues equivalent to those identified as functionally important in model organisms. For example, the residue equivalent to Arg210 in E. coli (Arg169 in Bacillus PS3) is highly conserved across species and tolerates very few mutations due to its essential role in proton release and prevention of proton leakage . Similarly, other functionally important residues like those equivalent to Glu196, Glu219, His245, Asp44, Asn214, and Gln252 in E. coli should be examined for conservation or variation in elephant MT-ATP6 .

Species-specific variations in less conserved regions may provide insights into adaptations related to metabolic requirements, thermal regulation, or other physiological characteristics unique to elephants. Comparative analysis using multiple sequence alignment and structural modeling tools can help identify these differences and their potential functional implications.

What are the optimal expression systems and purification methods for recombinant elephant MT-ATP6?

Expression and purification of recombinant elephant MT-ATP6 presents significant challenges due to its hydrophobic nature and multiple transmembrane domains. Based on successful approaches with other ATP synthase components, researchers should consider the following methodological workflow:

Expression Systems:

  • E. coli-based expression: Using specialized strains like C41(DE3) or C43(DE3) that are designed for membrane protein expression. The expression system used for Bacillus PS3 ATP synthase, which involved expression in E. coli strain DK8 (lacking endogenous ATP synthase), provides a useful model .

  • Insect cell expression: Baculovirus-infected Sf9 or Hi5 cells often yield better folding of complex mammalian membrane proteins.

  • Mammalian cell expression: HEK293 or CHO cells can provide more native-like post-translational modifications.

Purification Strategy:

  • Solubilization: Use mild detergents such as n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin.

  • Affinity Chromatography: Implement N-terminal or C-terminal affinity tags (His10 tag has been successful for Bacillus PS3 ATP synthase) , ensuring the tag doesn't interfere with protein folding.

  • Size Exclusion Chromatography: Remove aggregates and obtain uniform protein preparations.

  • Ion Exchange Chromatography: Further purify based on the unique charge characteristics of elephant MT-ATP6.

Quality Control Assessments:

  • Western blotting with specific antibodies

  • Mass spectrometry to confirm protein identity

  • Circular dichroism to verify secondary structure

  • Functional reconstitution in proteoliposomes to assess activity

When working with recombinant elephant MT-ATP6, researchers should be particularly attentive to maintaining the native structure through appropriate detergent selection and careful buffer optimization throughout the purification process.

What reconstitution methods are most effective for functional studies of recombinant elephant MT-ATP6?

For functional studies, recombinant elephant MT-ATP6 must be properly reconstituted into membrane systems that allow assessment of its proton translocation and ATP synthesis capabilities. The following methodological approaches are recommended:

Proteoliposome Reconstitution:

  • Lipid Selection: Use a mixture of phosphatidylcholine, phosphatidylethanolamine, and cardiolipin (4:4:2 ratio) to mimic the inner mitochondrial membrane composition.

  • Reconstitution Procedure:

    • Prepare liposomes by extrusion through polycarbonate filters

    • Destabilize liposomes with detergent (below critical micelle concentration)

    • Add purified MT-ATP6 at lipid-to-protein ratio of 50:1 to 100:1

    • Remove detergent using Bio-Beads or dialysis

    • Verify incorporation by freeze-fracture electron microscopy

Functional Assays:

  • Proton Translocation Assessment:

    • Monitor proton gradient formation using pH-sensitive fluorescent dyes like ACMA (9-amino-6-chloro-2-methoxyacridine)

    • Establish proton gradients and measure passive proton translocation rates

  • ATP Synthesis Coupling:

    • Co-reconstitute with other ATP synthase components

    • Establish proton gradient and measure ATP synthesis using luciferase-based assays

Similar approaches have been successful with bacterial ATP synthases, as demonstrated by studies with Bacillus PS3 ATP synthase in liposomes that showed proton translocation driven by either ΔpH or ΔΨ alone . These methodologies would need to be adapted specifically for the elephant protein, with careful attention to buffer conditions, pH, and lipid composition to optimize activity.

How can cryo-EM be utilized to determine the structure of elephant MT-ATP6 in the context of the complete ATP synthase complex?

Cryo-electron microscopy (cryo-EM) represents the most promising approach for determining the structure of elephant MT-ATP6 within the context of the complete ATP synthase complex. Based on successful strategies used for bacterial ATP synthase , the following methodological workflow is recommended:

Sample Preparation:

  • Expression and Purification: Express the complete ATP synthase complex with MT-ATP6 or reconstitute the complex from individually purified components

  • Detergent Selection: Use mild detergents like LMNG or digitonin that preserve native structure

  • Grid Preparation: Apply 3-4 μL of purified complex (1-3 mg/mL) to glow-discharged Quantifoil grids

  • Vitrification: Blot for 3-6 seconds and plunge-freeze in liquid ethane

Data Collection Parameters:

  • Microscope: 300 kV transmission electron microscope with direct electron detector

  • Dose: Total dose of ~50-60 e-/Ų fractionated across 40-50 frames

  • Defocus Range: -0.8 to -2.5 μm

  • Magnification: Resulting in pixel size of 0.8-1.0 Å/pixel

Image Processing Strategy:

  • Motion Correction: Correct beam-induced motion using MotionCor2

  • CTF Estimation: Determine defocus values using CTFFIND4 or Gctf

  • Particle Picking: Use reference-free auto-picking with validation by 2D classification

  • Classification: Perform multiple rounds of 2D and 3D classification to identify different rotational states

  • Focused Refinement: Apply the strategy used for Bacillus PS3 ATP synthase, where focused refinement of the membrane-embedded F₀ region significantly improved resolution

  • Map Validation: FSC analysis, local resolution estimation, and model-map correlation

Structural Analysis Focus:

  • Transmembrane helical arrangement of MT-ATP6

  • Interaction interfaces with c-ring and peripheral stalk

  • Proton translocation pathway including the two half-channels

  • Location of functionally critical residues equivalent to those identified in bacterial systems (e.g., Arg210 in E. coli)

What biophysical techniques are most informative for analyzing the conformational dynamics of elephant MT-ATP6?

Understanding the dynamic conformational changes of elephant MT-ATP6 during proton translocation requires a combination of complementary biophysical techniques:

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

  • Methodology: Expose protein to D₂O buffer for varying time periods (10 sec to 24 hr)

  • Analysis: Quench, digest, and analyze by LC-MS/MS to identify regions with different exchange rates

  • Interpretation: Slower exchange indicates protected regions; can identify conformational changes under different conditions (pH, membrane potential)

Site-Directed Spin Labeling with Electron Paramagnetic Resonance (SDSL-EPR):

  • Site Selection: Introduce cysteine residues at strategic positions in MT-ATP6

  • Labeling: Modify with nitroxide spin labels (e.g., MTSSL)

  • Measurements: Continuous wave and pulsed EPR to determine distances between labeled sites

  • Applications: Map distance changes during proton translocation events

Single-Molecule Förster Resonance Energy Transfer (smFRET):

  • Labeling Strategy: Attach donor and acceptor fluorophores to specific sites

  • Observation Method: Surface immobilization or freely diffusing molecules

  • Analysis: Monitor FRET efficiency changes over time to track conformational dynamics

  • Advantage: Can observe transient states missed by ensemble techniques

Molecular Dynamics Simulations:

  • Model Preparation: Build homology model of elephant MT-ATP6 based on available structures

  • Simulation System: Embed in lipid bilayer with explicit solvent and ions

  • Analysis: Run microsecond-scale simulations to identify conformational flexibility, proton pathways, and functional motions

  • Validation: Compare simulation predictions with experimental data from other biophysical methods

These complementary approaches would provide insights into how elephant MT-ATP6 changes conformation during the catalytic cycle, particularly how proton translocation through the half-channels might induce structural changes that contribute to c-ring rotation and subsequent ATP synthesis.

How can mutagenesis studies be designed to identify critical residues in elephant MT-ATP6?

Designing effective mutagenesis studies for elephant MT-ATP6 requires a targeted approach informed by evolutionary conservation analysis and structure-function relationships established in other species. The following methodological framework is recommended:

Target Residue Selection Strategy:

  • Homology-Based Targeting: Focus on residues equivalent to functionally important amino acids identified in other species, such as:

    • Arg210 (E. coli numbering): Critical for proton release and preventing short-circuiting

    • Glu196, Glu219: Important for proton translocation

    • His245, Asp44, Asn214, Gln252: Functionally important in bacterial systems

  • Conservation Analysis-Based Selection:

    • Perform multiple sequence alignment of MT-ATP6 across diverse mammalian species

    • Identify elephant-specific substitutions at otherwise conserved positions

    • Target these unique residues to understand elephant-specific adaptations

Mutation Types to Consider:

  • Conservative substitutions: Maintain similar physicochemical properties

  • Non-conservative substitutions: Change charge, size, or hydrophobicity

  • Cysteine substitutions: Enable subsequent chemical modification or crosslinking studies

  • Alanine scanning: Systematically replace segments with alanine to identify functional regions

Expression and Functional Analysis Workflow:

  • Expression System: Use complementation systems where the recombinant MT-ATP6 can rescue function in a knockout background

  • Functional Assays:

    • ATP synthesis rate measurements

    • Proton translocation assays

    • Membrane potential sensitivity analysis

    • ATP synthase assembly verification

Data Analysis Framework:

Mutation CategoryExpected OutcomeInterpretation
Proton path residuesReduced/abolished activityDirectly involved in proton translocation
Interface residuesAssembly defectsImportant for subunit interactions
Allosteric residuesAltered kinetics without assembly defectsInvolved in conformational coupling
Elephant-specific residuesAltered thermal stability or kineticsReflects evolutionary adaptation

Mutations affecting residues equivalent to those found crucial in bacterial systems (such as Arg210 in E. coli) would be expected to significantly disrupt function, while mutations in elephant-specific residues might reveal adaptive properties related to the unique physiology of these large mammals.

What approaches can determine how elephant MT-ATP6 contributes to the proton translocation mechanism?

Investigating the specific contribution of elephant MT-ATP6 to proton translocation requires a combination of functional, biophysical, and computational approaches tailored to membrane protein analysis:

Proton Pathway Mapping:

  • Cysteine Accessibility Scanning:

    • Systematically introduce cysteine residues throughout MT-ATP6

    • Test accessibility with membrane-permeant and impermeant thiol reagents

    • Map accessible residues to identify potential proton-conducting channels

  • pH-Sensitive Fluorescent Probes:

    • Incorporate unnatural amino acids with pH-sensitive fluorophores

    • Position at predicted channel locations

    • Monitor fluorescence changes during proton translocation events

Electrophysiological Characterization:

  • Patch Clamp Analysis of Reconstituted Proteoliposomes:

    • Measure proton currents at different membrane potentials

    • Determine conductance properties and ion selectivity

    • Compare wild-type to strategically selected mutants

  • Solid-Supported Membrane Electrophysiology:

    • Adsorb proteoliposomes containing MT-ATP6 onto solid-supported membranes

    • Measure capacitive currents upon rapid substrate concentration jumps

    • Determine voltage dependence of proton translocation

Computational Approaches:

  • Molecular Dynamics Simulations of Proton Transfer:

    • Implement constant pH molecular dynamics

    • Model protonation/deprotonation events along putative pathways

    • Calculate energy barriers for proton movement

  • Quantum Mechanics/Molecular Mechanics (QM/MM) Calculations:

    • Apply quantum mechanical treatment to regions directly involved in proton transfer

    • Calculate reaction energetics along the translocation pathway

    • Identify rate-limiting steps in the proton transfer mechanism

Structural Validation of Proton Pathways:

  • Crosslinking Analysis:

    • Introduce pairs of cysteines at predicted half-channel boundaries

    • Assess crosslinking efficiency under different conditions

    • Validate structural models of the proton-conducting paths

These approaches would build upon insights from bacterial ATP synthase studies, which have identified two offset half-channels as the core structural feature enabling proton translocation . The goal would be to determine whether elephant MT-ATP6 employs similar mechanisms, potentially with specialized adaptations related to the animal's unique bioenergetic requirements.

How does the structure-function relationship of elephant MT-ATP6 reflect evolutionary adaptations to the species' metabolic demands?

The structure-function relationship of elephant MT-ATP6 likely reflects evolutionary adaptations to the unique metabolic demands of these large mammals. Investigating these adaptations requires integrating structural analysis with comparative biology approaches:

Comparative Sequence Analysis Framework:

  • Phylogenetic Profiling:

    • Construct phylogenetic trees based on MT-ATP6 sequences across diverse mammalian orders

    • Identify elephant-specific substitutions and their conservation within Proboscidea

    • Correlate substitutions with known metabolic traits (body size, thermoregulation capacity)

  • Selection Pressure Analysis:

    • Calculate dN/dS ratios to identify positively selected residues

    • Map selected sites onto structural models to determine functional implications

    • Compare selection patterns between different mammalian lineages

Structure-Based Comparative Analysis:

  • Homology Modeling:

    • Generate structural models of elephant MT-ATP6 based on available ATP synthase structures

    • Compare with models from other species varying in body size and metabolic rate

    • Identify structural differences in proton channels or subunit interfaces

  • Biophysical Property Comparison:

    • Analyze differences in hydrophobicity profiles of transmembrane regions

    • Examine electrostatic potential landscapes around proton-conducting channels

    • Compare predicted stability under different temperature conditions

Metabolic Context Analysis:

  • Correlation with Metabolic Parameters:

    • Examine relationships between MT-ATP6 sequence features and:

      • Basal metabolic rate adjusted for body mass

      • Thermoregulatory capacity

      • Mitochondrial density in different tissues

  • Respiratory Efficiency Assessment:

    • Compare P/O ratios (ATP produced per oxygen consumed) across species

    • Analyze potential contributions of MT-ATP6 variations to efficiency differences

    • Evaluate hypotheses regarding proton leak and thermal regulation

Elephants face unique bioenergetic challenges related to their large body size, extended lifespan, and thermoregulatory needs. These challenges may have driven adaptations in MT-ATP6 that optimize ATP production efficiency, regulate proton leak for heat generation, or enhance stability under various physiological conditions. Bacterial ATP synthase studies have shown that even minor structural variations can significantly impact function , suggesting that elephant-specific features of MT-ATP6 may have important functional consequences.

What insights can comparative analysis of elephant MT-ATP6 with other mammalian species provide about mitochondrial disease mutations?

Comparative analysis of elephant MT-ATP6 with other mammalian species can provide valuable insights into mitochondrial disease mutations, particularly those affecting ATP synthase function. The following analytical framework is recommended:

Mutation Impact Assessment Strategy:

  • Conservation Pattern Analysis:

    • Align MT-ATP6 sequences across diverse mammalian species including elephants

    • Identify positions with absolute conservation (likely critical for function)

    • Locate positions with lineage-specific conservation patterns (potentially adaptive)

    • Map known human disease mutations onto alignment

  • Structural Context Evaluation:

    • Position disease mutations in 3D structural models

    • Compare local environment between human and elephant MT-ATP6

    • Identify compensatory mutations in elephant that might mitigate effects of disease variants

Functional Prediction Framework:

  • In Silico Mutation Analysis:

    • Use computational approaches to predict stability changes upon mutation

    • Compare predicted impacts between human and elephant backgrounds

    • Identify potential stabilizing features in elephant MT-ATP6

  • Experimental Validation:

    • Introduce human disease mutations into recombinant elephant MT-ATP6

    • Compare functional consequences to the same mutations in human protein

    • Identify differential effects that might suggest protective mechanisms

Mitochondrial Disease Relevance Table:

Human Disease MutationConservation in ElephantPredicted Structural ImpactPotential Compensatory Features
L156R (NARP/MILS)Conserved/Not conservedDisruption of hydrophobic interactionsAnalysis of surrounding residues
L217P (NARP/MILS)Conserved/Not conservedHelix distortionAnalysis of helix stability features
M140V (FBSN)Conserved/Not conservedAltered packingAnalysis of transmembrane domain stability

Longevity and Disease Resistance Connection:
Elephants have exceptionally long lifespans for their body size, suggesting they may have evolved protective mechanisms against age-related mitochondrial dysfunction. Analysis of elephant MT-ATP6 may reveal:

  • Enhanced structural stability features that prevent misfolding

  • Optimized proton translocation pathways with reduced leak potential

  • Compensatory mechanisms that buffer against potentially damaging mutations

This comparative approach leverages evolutionary conservation and divergence patterns to better understand the functional impact of disease-associated mutations and potentially identify novel therapeutic strategies based on naturally evolved solutions in long-lived species like elephants.

How can recombinant elephant MT-ATP6 be utilized in drug discovery for mitochondrial disorders?

Recombinant elephant MT-ATP6 offers unique opportunities for drug discovery targeting mitochondrial disorders, particularly those involving ATP synthase dysfunction. The following methodological framework outlines how this protein can be leveraged in therapeutic development:

Screening Platform Development:

  • Functional Assay Optimization:

    • Reconstitute recombinant elephant MT-ATP6 in proteoliposomes

    • Establish fluorescence-based proton translocation assays

    • Develop high-throughput adaptations suitable for compound screening

  • Comparative Screening Strategy:

    • Screen compounds against both human and elephant MT-ATP6

    • Identify compounds that selectively rescue human disease mutants

    • Use elephant protein as a structural template for optimizing therapeutic candidates

Structure-Based Drug Design Approach:

  • Binding Site Identification:

    • Use computational approaches to identify druggable pockets in MT-ATP6

    • Compare pocket architecture between elephant and human proteins

    • Focus on sites that could modulate proton translocation or protein stability

  • Fragment-Based Screening:

    • Screen fragment libraries against recombinant MT-ATP6

    • Identify binding events using thermal shift assays, NMR, or crystallography

    • Develop fragments into lead compounds through medicinal chemistry

Therapeutic Mechanism Exploration:

  • Modulation of Proton Leak:

    • Identify compounds that can reduce pathological proton leak

    • Test effects on ATP production efficiency

    • Compare efficacy between wild-type and disease mutant proteins

  • Protein Stability Enhancement:

    • Screen for pharmacological chaperones that stabilize disease mutants

    • Use elephant MT-ATP6 stability features as design templates

    • Assess improvements in protein folding and assembly

Translational Research Pathway:

  • Cellular Model Validation:

    • Test lead compounds in cell lines expressing disease mutants

    • Measure effects on mitochondrial membrane potential and ATP production

    • Compare results with computational predictions from structure-based design

  • Target Validation Strategy:

    • Utilize CRISPR-based approaches to introduce elephant-specific residues into human cells

    • Assess whether these modifications confer protection against mitochondrial dysfunction

    • Use insights to refine therapeutic approaches

Leveraging the unique structural and functional properties of elephant MT-ATP6 could lead to novel therapeutic strategies for mitochondrial disorders, particularly those involving proton leakage, compromised ATP production, or ATP synthase stability issues. The comparative approach, using insights from evolutionary adaptations in elephants, provides a powerful framework for drug discovery that goes beyond conventional approaches.

What are the challenges and solutions for integrating recombinant elephant MT-ATP6 into synthetic biological systems?

Integrating recombinant elephant MT-ATP6 into synthetic biological systems presents several challenges due to its complex membrane protein nature, but also offers unique opportunities for creating novel bioenergetic platforms. The following methodological framework addresses these challenges and potential solutions:

Expression and Assembly Challenges:

  • Heterologous Expression Optimization:

    • Challenge: Proper folding and membrane insertion in non-native environments

    • Solution: Design synthetic genes with optimized codons and expression signals

    • Validation: Monitor protein localization using fluorescent tags and functional assays

  • Chimeric Complex Engineering:

    • Challenge: Compatibility with other ATP synthase components

    • Solution: Design interface-optimized chimeras combining elephant MT-ATP6 with subunits from host organisms

    • Experimental Approach: Systematic testing of different junction points guided by structural data

Functional Integration Challenges:

  • Proton Gradient Compatibility:

    • Challenge: Matching MT-ATP6 proton translocation properties with synthetic membrane systems

    • Solution: Design tunable proton gradient generation systems (light-driven pumps, pH-responsive nanopores)

    • Measurement: Quantify ATP production efficiency under varying gradient conditions

  • Regulatory Control Implementation:

    • Challenge: Controlling activity in response to system demands

    • Solution: Engineer allosteric regulation sites or post-translational modification targets

    • Validation: Measure response dynamics to different regulatory inputs

Synthetic Biology Application Platforms:

ApplicationTechnical ApproachExpected AdvantagesChallenges
Biohybrid Power CellsCouple with artificial photosystemsEnhanced energy conversion efficiencyStability at biological-electronic interfaces
ATP-Driven NanomachinesIntegration with DNA/protein nanomachinesContinuous energy supply for extended operationSpatial coupling and energy transfer efficiency
Metabolic EngineeringEnhance ATP production in industrial microorganismsImproved yield of ATP-dependent productsBalancing with native metabolism

Stability and Longevity Solutions:

  • Membrane Environment Optimization:

    • Challenge: Maintaining long-term stability in artificial systems

    • Solution: Screen lipid compositions and membrane stabilizers

    • Measurement: Monitor activity retention over extended timeframes

  • Directed Evolution Strategy:

    • Challenge: Optimizing elephant MT-ATP6 for synthetic biology applications

    • Solution: Develop high-throughput screening systems to evolve variants with enhanced stability or activity

    • Methodology: Combine error-prone PCR with functional selection in model organisms

The successful integration of elephant MT-ATP6 into synthetic biological systems would benefit from insights gained from structural studies of ATP synthases, particularly regarding how the relatively simple bacterial ATP synthases perform the same core functions as more complex mitochondrial systems . This comparative understanding could guide the design of minimalist synthetic systems that maintain essential functionality while offering improved tractability for engineering applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.