Recombinant Elephas maximus Cytochrome c oxidase subunit 2 (MT-CO2)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Note: The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Elephas maximus (Indian elephant)
Target Names
Target Protein Sequence
MAYPLQLGFQDATSPVMEELLHFHDHTLMIIFLISSLVLYIIMLMLTTKLIHTNMMNVQE
MEMIWTILPAIILILIALPSLHTLYMMDEINNPLLTIKTMGHQWFWSYEYTDYEDLAFDS
YMITTDSLKFGELRLLEVDNRMVLPTDLPVRVLVSSEDVLHSWAVPSLGLKTDAIPGRLN
QVTLTSMRPGLFYGQCSEICGANHSFMPIVLELVPLKYFESWSASLA
Uniprot No.
Target Background
Function
Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This complex drives oxidative phosphorylation by cooperating with succinate dehydrogenase (complex II, CII) and ubiquinol-cytochrome c oxidoreductase (complex III, CIII) to transfer electrons from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, fueling transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the Cu(A) center of subunit 2 and heme a of subunit 1 to the binuclear center (BNC) in subunit 1, consisting of heme a3 and Cu(B). The BNC reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
