MT-ND6 is a mitochondrially encoded hydrophobic subunit of NADH dehydrogenase (Complex I), the first enzyme in the electron transport chain. In Elephas maximus, recombinant MT-ND6 retains the conserved functional domains necessary for:
The recombinant protein is synthesized to study its role in mitochondrial dysfunction-linked diseases and evolutionary adaptations in large mammals .
Recombinant Elephas maximus MT-ND6 is produced using bacterial or eukaryotic expression systems. For example:
| Parameter | Specification | Source |
|---|---|---|
| Expression Host | Escherichia coli | |
| Tag | Determined during production (e.g., His tag) | |
| Purity | >90% (SDS-PAGE verified) |
The full-length protein (1–175 amino acids) includes conserved regions critical for ubiquinone binding and proton translocation :
Sequence (Partial):
MMYIVFIMSVLYVVGFIGFSSKPSPVYGGMSLVVSGGLGCGIIMSSGGSFLGLVVFLVYL...
| Property | Value | Source |
|---|---|---|
| Molecular Weight | ~22 kDa (calculated) | |
| Storage | -20°C in Tris buffer with 50% glycerol | |
| Stability | Avoid repeated freeze-thaw cycles |
Mutations in MT-ND6 are linked to Leigh syndrome and Leber’s hereditary optic neuropathy in humans . Recombinant Elephas maximus MT-ND6 enables comparative studies to:
Elephants exhibit unique metabolic demands due to their large body size. Recombinant MT-ND6 helps investigate:
Commercial ELISA kits for MT-ND6 (e.g., Cusabio’s Human MT-ND6 ELISA Kit) demonstrate cross-reactivity principles applicable to elephant studies :
| Parameter | Value | Source |
|---|---|---|
| Detection Range | 23.44–1500 pg/mL | |
| Sensitivity | 5.86 pg/mL | |
| Recovery Rate | 85–98% (serum/plasma) |
The structure of MT-ND6 is characterized by multiple alpha-helical transmembrane domains that are critical for its integration into Complex I and its functional contributions to energy metabolism. In the case of Elephas maximus MT-ND6, the full protein consists of 175 amino acids with a sequence that begins with "MMYIVFIMSVLYVVGFIGFSSK" and contains several hydrophobic regions typical of membrane-embedded proteins . Structural analyses reveal that the C-terminal region of MT-ND6 contains three alpha helices that are particularly important for interactions with the Q module of Complex I, establishing the protein's role as a bridge between different functional domains of the complex . When these C-terminal alpha helices are compromised or absent, as observed in certain mutations, the stability and activity of Complex I are significantly impaired . Molecular dynamics simulations have demonstrated that truncations affecting the C-terminal region lead to conformational rearrangements rather than complete unfolding, which may explain how mutant forms can still interact with Complex I but disrupt its proper assembly and function . The specific positioning of MT-ND6 within Complex I allows it to contribute to the formation of the E-channel, which is essential for electron flow during oxidative phosphorylation .
The regulation of MT-ND6 gene expression involves several mechanisms, including epigenetic modifications that can significantly impact mitochondrial function in various disease states. Research has demonstrated that methylation of the MT-ND6 gene region can serve as an important regulatory mechanism, with studies showing approximately 20% higher methylation levels in patients with non-alcoholic steatohepatitis (NASH) compared to individuals in earlier stages of the disease . This increased methylation correlates with a substantial decrease (>50%) in both MT-ND6 mRNA and protein expression, suggesting a direct link between epigenetic regulation and functional outcomes . Unlike some other mitochondrial genes, MT-ND6 methylation patterns appear to be specifically associated with disease progression, as similar correlations were not observed for other mitochondrial genes such as MT-COI or the D-loop region . Since MT-ND6 encodes a crucial subunit of Complex I, alterations in its expression due to methylation can negatively impact mitochondrial function, particularly affecting lipid metabolism and potentially contributing to disease pathogenesis . This epigenetic regulation represents an important layer of control over MT-ND6 expression beyond the traditional mechanisms governing mitochondrial gene transcription and translation.
Recombinant MT-ND6 proteins require specific storage and handling conditions to maintain their structural integrity and functional properties for research applications. For Elephas maximus recombinant MT-ND6, storage in a Tris-based buffer containing 50% glycerol is recommended, as this formulation has been optimized to preserve protein stability . The protein should be stored at -20°C for routine use, while extended storage periods warrant temperatures of -20°C or preferably -80°C to minimize degradation over time . Researchers should avoid repeated freeze-thaw cycles, as these can progressively denature the protein and compromise experimental results; instead, working aliquots should be prepared and stored at 4°C for up to one week to minimize structural damage while maintaining accessibility for experiments . When reconstituting lyophilized preparations or diluting stock solutions, it is advisable to use the same buffer composition as the storage buffer to avoid introducing conditions that might destabilize the protein structure. For experimental work requiring longer-term stability at working temperatures, researchers should consider supplementing buffers with reducing agents or protease inhibitors to prevent oxidation and proteolytic degradation that could compromise the functional integrity of the recombinant protein.
Multiple expression systems can be employed for producing recombinant MT-ND6, each with distinct advantages depending on the specific research application and downstream analysis requirements. For basic structural studies and antibody production, bacterial expression systems such as E. coli can provide high yields, though proper folding of this membrane protein may be challenging without optimization of growth conditions and the potential use of fusion tags to enhance solubility . Eukaryotic expression systems, particularly insect cells using baculovirus vectors, offer improved post-translational modifications and membrane protein folding capacity, making them suitable for producing MT-ND6 for functional studies where proper conformation is critical. For studying MT-ND6 mutations and their effects on Complex I assembly, mammalian cell-based expression systems can be particularly valuable, especially when combined with techniques to generate cytoplasmic hybrid (cybrid) cell lines that allow controlled introduction of mutant mitochondrial DNA against a consistent nuclear background . These cybrid models have been successfully employed to study the m.14487T>C mutation in MT-ND6 and can be created by fusing mtDNA-lacking cells (such as 143B cells) with platelets from patients carrying the mutation of interest . When selecting an expression system, researchers should consider the intended application, required protein yield, and whether post-translational modifications are necessary for the specific aspects of MT-ND6 being investigated.
Validating the structural integrity of recombinant MT-ND6 proteins requires a multi-faceted approach combining biochemical, biophysical, and functional analyses to ensure that the recombinant protein accurately represents the native state. Initially, basic characterization through SDS-PAGE and western blotting using antibodies targeting different epitopes of MT-ND6 (such as N-terminal and C-terminal specific antibodies) can confirm the expected molecular weight and immunoreactivity of the recombinant protein . More sophisticated structural validation can be achieved through circular dichroism spectroscopy to assess secondary structure content, particularly the alpha-helical components that are essential to MT-ND6 function. For detailed structural analysis, molecular dynamics simulations can provide valuable insights into protein stability and conformational characteristics, as demonstrated in studies examining parameters such as Root Mean Square Fluctuation (RMSF), Solvent Accessible Surface Area (SASA), and the preservation of native contacts . Functional validation can be performed by incorporating the recombinant protein into liposomes or nanodiscs and measuring electron transfer activity or by assessing its ability to complement Complex I deficiency in suitable cellular models. Additionally, researchers can use Blue Native PAGE (BN-PAGE) to evaluate whether the recombinant MT-ND6 can properly incorporate into Complex I structures, either in reconstitution experiments or when expressed in appropriate cellular systems .
Investigating MT-ND6 protein-protein interactions requires specialized approaches that account for its hydrophobic nature and integration within the multi-subunit Complex I. Co-immunoprecipitation using antibodies against either MT-ND6 or potential interacting partners can identify stable interactions, though membrane protein solubilization conditions must be carefully optimized to maintain native interactions while achieving sufficient protein extraction . Proximity labeling methods such as BioID or APEX2, where MT-ND6 is fused to a biotin ligase or peroxidase, can capture even transient or weak interactions in the native mitochondrial environment by biotinylating nearby proteins that can subsequently be purified and identified by mass spectrometry. Blue Native PAGE combined with second-dimension SDS-PAGE offers an effective approach for analyzing MT-ND6 interactions within the context of respiratory complexes, allowing visualization of both assembled complexes and individual interacting components . For studying the dynamics of MT-ND6 interactions during Complex I assembly or under pathological conditions, pulse-chase experiments with inducible expression systems can track the formation and stability of protein-protein contacts over time. Advanced structural techniques such as cryo-electron microscopy have been particularly valuable for resolving the detailed interaction network of MT-ND6 within the complete Complex I structure, revealing critical contact points with both neighboring subunits and the lipid environment of the inner mitochondrial membrane.
Mutations in MT-ND6 have been implicated in several human diseases, with distinct molecular mechanisms underlying their pathological effects. In Leber hereditary optic neuropathy (LHON), specific MT-ND6 gene variants alter single amino acids in the protein, affecting approximately 14% of all LHON cases, with particularly high prevalence among French Canadian populations . These mutations typically impair Complex I function, leading to reduced ATP production, increased reactive oxygen species generation, and ultimately retinal ganglion cell death that results in vision loss. A novel mechanism has been identified in hepatocellular carcinoma, where a specific deletion (m.14423 A>-) causes a frameshift in the MT-ND6 gene, creating an early stop codon that produces a truncated form of the protein (ΔND6) with approximately 50% of the C-terminal sequence missing . This truncated protein negatively impacts Complex I stability and activity, potentially contributing to the metabolic reprogramming characteristic of cancer cells . In mitochondrial disease associated with the m.14487T>C mutation, systematic analysis shows that the relationship between mutant load and phenotypic expression is complex, suggesting additional factors influencing disease manifestation . Non-alcoholic steatohepatitis (NASH) presents yet another pathological mechanism, where hypermethylation of the MT-ND6 gene region leads to decreased gene expression, compromising mitochondrial function and exacerbating metabolic dysfunction in the liver .
Optimizing cellular models for MT-ND6 mutation studies requires careful consideration of both the background cell type and methodological approaches to ensure physiologically relevant results. Cybrid cell lines represent a gold standard approach, created by fusing mtDNA-depleted cells (typically 143B osteosarcoma cells) with platelets from patients carrying MT-ND6 mutations, thereby allowing the study of mitochondrial mutations against a consistent nuclear genetic background . To ensure experimental rigor, researchers should generate multiple independent cybrid clones with varying levels of mutation heteroplasmy, allowing for dose-response analyses that correlate mutational burden with phenotypic outcomes . Quality control measures are essential, including regular testing for mycoplasma contamination using detection kits such as MycoAlert PLUS and maintenance of mycoplasma-free cultures with agents like BM-Cyclin . Karyotype analysis should be performed to confirm chromosomal stability, using techniques such as colchicine treatment followed by metaphase spread preparation and analysis of approximately 20 metaphase cells per line . For visualization of mitochondrial morphology and distribution, immunofluorescence microscopy with antibodies against mitochondrial markers like HSP60 provides valuable insights, with protocol optimization including paraformaldehyde fixation, overnight primary antibody incubation at 4°C, and confocal microscopy at 600× magnification .
The connection between MT-ND6 mutations and hepatocellular carcinoma (HCC) development represents an emerging area of research with significant implications for understanding cancer metabolism and potential therapeutic approaches. A recent study identified a novel mutation in the MT-ND6 gene in tumor tissue from a patient with HCC who lacked typical risk factors such as viral hepatitis or alcohol abuse and maintained normal liver function, a rare combination occurring in only about 10% of HCC cases . This mutation, a thymidine deletion (m.14423 A>-) present in 70% of mtDNA molecules in the tumor, created a frameshift leading to an early stop codon and resulting in a truncated form of the ND6 protein (ΔND6) missing 50% of its C-terminal sequence . Biochemical analysis revealed that this truncated protein negatively impacted Complex I stability and activity without affecting other respiratory chain complexes, suggesting a specific role in altering mitochondrial energy metabolism . Molecular dynamics simulations further confirmed that the truncated ΔND6 undergoes conformational rearrangements rather than complete unfolding, allowing it to interact with Complex I components but disrupting normal assembly and function, potentially contributing to the metabolic reprogramming that supports cancer cell proliferation . This finding adds to growing evidence that mitochondrial mutations, particularly those affecting respiratory complex subunits like MT-ND6, may play more significant roles in cancer development than previously recognized, especially in cases without traditional risk factors.
Molecular dynamics simulations provide powerful insights into the structural dynamics and functional implications of MT-ND6 variants that cannot be easily obtained through experimental methods alone. These computational approaches can reveal how mutations affect protein stability and conformation by tracking parameters such as Residual Mean Square Fluctuation (RMSF), which has demonstrated elevated movement in the N-terminal region of truncated ΔND6 compared to the conformationally stable wild-type protein . Solvent Accessible Surface Area (SASA) analysis through molecular dynamics offers critical information about structural compactness, as seen in studies showing that truncated MT-ND6 adopts a more compact conformation than the wild-type protein, with low fluctuations in solvent accessibility suggesting specific conformational rearrangements rather than general unfolding . The preservation of native contacts can be quantitatively assessed through simulation, revealing that while ΔND6 loses approximately one-quarter of its original contacts during simulation, the retained fraction remains stable in later stages, indicating adaptation to a modified but relatively stable conformation . Beyond individual protein analysis, molecular dynamics can model interactions between MT-ND6 and other Complex I components, predicting how mutations might disrupt critical interfaces such as those involved in forming the E-channel necessary for electron flow . For researchers investigating novel MT-ND6 variants, molecular dynamics simulations can generate testable hypotheses about functional impacts before investing in resource-intensive experimental validation, particularly valuable when working with mutations of unknown significance.
Investigating epigenetic modifications of MT-ND6 requires specialized methodologies adapted for mitochondrial DNA that differ from traditional nuclear DNA epigenetic analysis. Bisulfite sequencing remains a cornerstone technique for analyzing DNA methylation, though protocols must be optimized for mitochondrial DNA to account for its circular nature and unique genomic features; this approach has successfully demonstrated increased MT-ND6 methylation (approximately 20% higher) in non-alcoholic steatohepatitis patients compared to those in earlier disease stages . Methylated DNA immunoprecipitation (MeDIP) using antibodies specific to 5-methylcytosine provides another valuable approach for analyzing MT-ND6 methylation patterns, allowing enrichment of methylated regions followed by qPCR or sequencing to quantify methylation levels across specific genomic regions. For broader epigenetic analysis, chromatin immunoprecipitation sequencing (ChIP-seq) adapted for mitochondrial nucleoids can identify protein-DNA interactions that may regulate MT-ND6 expression, including potential binding of transcription factors or other regulatory proteins. To establish functional consequences of methylation, researchers should correlate epigenetic profiles with MT-ND6 expression levels using RT-qPCR and western blotting, as studies have shown that increased methylation correlates with >50% reduction in both mRNA and protein expression . Integrative approaches combining methylation analysis with assessments of mitochondrial function, such as oxygen consumption rates and Complex I activity assays, can establish mechanistic links between epigenetic changes, gene expression alterations, and functional outcomes in disease states.
Cybrid (cytoplasmic hybrid) cell models represent a powerful experimental system for investigating the specific effects of MT-ND6 mutations isolated from the confounding influence of nuclear genetic variation. The creation of these models begins with the fusion of mtDNA-depleted cells (ρ0 cells, such as 143B osteosarcoma cells) with patient-derived platelets containing the MT-ND6 mutation of interest, followed by selection for successful cytoplasmic hybrids . To maximize research value, researchers should generate multiple independent cybrid clones with varying heteroplasmy levels (percentage of mutant mtDNA), allowing for dose-response analyses that correlate mutational burden with phenotypic outcomes. Comprehensive characterization of cybrid models should span multiple analytical dimensions—transcriptomic analysis can reveal compensatory gene expression changes, metabolomic profiling can identify altered metabolic pathways, and biochemical assays can quantify specific functional deficits in oxidative phosphorylation . For rigorous experimental design, comparisons should include not only mutant versus wild-type cybrids but also additional controls such as cybrids carrying different mtDNA mutations affecting the same or different respiratory complexes, enabling distinction between mutation-specific effects and general consequences of respiratory chain dysfunction . Advanced applications of cybrid models include three-dimensional culture systems that better recapitulate tissue architecture, co-culture with other cell types to examine intercellular interactions, and differentiation of pluripotent cybrid cells to study tissue-specific manifestations of MT-ND6 mutations in various cellular contexts.
Cross-species analysis of MT-ND6 offers valuable perspectives for understanding human mitochondrial disorders by highlighting evolutionarily conserved regions that likely serve critical functional roles across diverse organisms. By examining sequences from species ranging from elephants to rainbow trout (Oncorhynchus mykiss), researchers can identify universally conserved amino acid residues that, when mutated in humans, are most likely to cause pathological effects . This comparative approach is particularly valuable for interpreting novel variants of uncertain significance, as mutations affecting highly conserved residues across species generally have greater functional impact than those in variable regions. Animal models expressing homologous MT-ND6 mutations can serve as experimental systems to investigate pathogenic mechanisms and potential therapeutic approaches, with the degree of phenotypic similarity to human disease often correlating with the evolutionary distance between species. Comparative analysis has revealed that certain disease-associated human MT-ND6 mutations occur at positions that show natural variation in other species, suggesting the existence of compensatory mechanisms or nuclear genetic modifiers that could be therapeutically relevant if identified and understood. Studies of MT-ND6 in long-lived species like elephants may provide insights into mechanisms of mitochondrial maintenance and quality control that contribute to longevity, potentially informing approaches to mitigate mitochondrial dysfunction in human aging and disease . Cross-species analysis can also identify lineage-specific selection pressures on MT-ND6, revealing adaptations to particular metabolic demands that may explain tissue-specific manifestations of mitochondrial disorders.
Optimizing cross-species sequence alignment for MT-ND6 functional studies requires specialized approaches that account for both the protein's evolutionary constraints and its unique structural characteristics as a mitochondrially-encoded membrane protein. Rather than applying standard global alignment algorithms, researchers should implement profile-based multiple sequence alignment methods that incorporate position-specific scoring matrices derived from curated sets of functionally characterized MT-ND6 sequences. Structurally-informed alignment strategies that weight conservation based on known functional domains prove particularly valuable for MT-ND6, giving higher priority to transmembrane regions and sites involved in interactions with other Complex I subunits, such as the three C-terminal alpha helices that interact with the Q module . When comparing distantly related species such as Elephas maximus and Oncorhynchus mykiss, local alignment approaches focusing on functional motifs may yield more biologically relevant information than forcing alignment across highly divergent regions . Researchers should incorporate structural information from cryo-electron microscopy studies of Complex I when available, using this data to guide alignment of regions with defined secondary structure elements. After generating alignments, validation through metrics beyond simple sequence identity is essential, including analysis of physicochemical property conservation, evaluation of hydrophobicity profiles for transmembrane domains, and assessment of coevolutionary patterns between interacting residues. These optimized alignment approaches enable more accurate functional predictions for novel MT-ND6 variants and identification of residues under selective pressure that may represent critical functional sites or species-specific adaptations.