Recombinant Eligmodontia typus NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Introduction to MT-ND3

NADH-ubiquinone oxidoreductase chain 3 (MT-ND3) is a critical component of the mitochondrial respiratory chain complex I (NADH dehydrogenase). This protein plays a fundamental role in cellular energy production through oxidative phosphorylation. The MT-ND3 gene is encoded by mitochondrial DNA (mtDNA) and produces a protein essential for the assembly and function of complex I, which is the largest complex in the electron transport chain .

The recombinant form of MT-ND3 from Eligmodontia typus represents a synthetically produced version of this naturally occurring protein, enabling researchers to study its properties outside of its native environment. Eligmodontia typus, commonly known as the Highland gerbil mouse, is a rodent species found in South America, particularly in the arid regions of Argentina, Bolivia, and Chile .

Biological Context

MT-ND3 functions within the inner mitochondrial membrane as part of the respiratory chain complex I, which is responsible for transferring electrons from NADH to ubiquinone (coenzyme Q). This electron transfer is coupled with proton translocation across the inner mitochondrial membrane, contributing to the establishment of a proton gradient used for ATP synthesis . Variations in MT-ND3 can significantly impact mitochondrial function, with certain mutations linked to severe mitochondrial disorders such as Leigh syndrome and mitochondrial complex I deficiency .

Biochemical Properties

The recombinant MT-ND3 protein has several key features that characterize its biochemical properties:

PropertyDescription
UniProt IDO21549
Enzyme Commission NumberEC 1.6.5.3
Protein Length115 amino acids (full length)
Expression Region1-115
Alternative NamesNADH dehydrogenase subunit 3
Gene SynonymsMTND3, NADH3, ND3

Table 1. Biochemical properties of Recombinant Eligmodontia typus MT-ND3

Recombinant Production

The recombinant Eligmodontia typus MT-ND3 protein is produced through heterologous expression systems, likely using similar methods to those employed for other recombinant mitochondrial proteins. While the specific production methods for this particular protein are not detailed in the search results, comparable recombinant mitochondrial proteins are often expressed in Escherichia coli expression systems .

Role in Mitochondrial Function

MT-ND3 serves as an integral component of respiratory complex I, which is the first and largest enzyme complex in the mitochondrial respiratory chain. This complex catalyzes the transfer of electrons from NADH to ubiquinone, coupled with the translocation of protons across the inner mitochondrial membrane. This process is crucial for establishing the electrochemical gradient that drives ATP synthesis .

The specific function of MT-ND3 within complex I includes:

  1. Contributing to the structural integrity of the membrane domain of complex I

  2. Participating in the proton translocation machinery

  3. Supporting the assembly and stability of the entire complex

Impact of MT-ND3 Variants

Research has demonstrated that variants in MT-ND3 can significantly impact mitochondrial function. For instance, the m.10197G>C variant has been shown to significantly lower MT-ND3 protein levels, resulting in complex I assembly and activity deficiency, and consequently, reduced ATP synthesis . Similarly, the m.10191T>C variant has been associated with mitochondrial dysfunction . These findings highlight the critical importance of MT-ND3 in maintaining proper mitochondrial function.

Biochemical and Functional Studies

Recombinant Eligmodontia typus MT-ND3 protein can serve as a valuable tool for biochemical and functional studies of mitochondrial complex I. Potential research applications include:

  1. Structural studies of complex I assembly and function

  2. Investigation of protein-protein interactions within the respiratory chain

  3. Comparative studies of mitochondrial function across different rodent species

  4. Development of antibodies for detection and quantification of MT-ND3 in biological samples

Therapeutic Exploration

Recent research has explored innovative approaches to address mitochondrial dysfunction caused by MT-ND3 variants. One promising strategy involves allotopic expression, where nuclear-encoded, codon-optimized mitochondrial genes are targeted to mitochondria. This approach has shown potential in rescuing defects arising from MT-ND3 variants by partially restoring protein levels, complex I assembly, and ATP production .

The availability of recombinant MT-ND3 proteins can support such therapeutic exploration by providing reference material for functional assays and validation studies.

Phylogenetic Context

MT-ND3, along with other mitochondrial genes such as cytochrome b and the control region, has been used as a marker for phylogenetic analyses of rodent species, including the genus Graomys, which is related to Eligmodontia . These molecular markers help elucidate evolutionary relationships and divergence patterns among rodent lineages in South America.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Eligmodontia typus (Highland gerbil mouse)
Target Names
Target Protein Sequence
MNAIVILFINATLSLGLITVAFWLPHLNIYAEKAGAYECGFDPMSSARLPFSMKFFLIGI TFLLFDLEITLLLPLPWAMHSTNTYFTMLVSFLLVSVLALGLMYEWTNKGLEWTE
Uniprot No.

Target Background

Function
This protein serves as a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor. Its presence is crucial for the catalytic activity of complex I.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND3 and what role does it play in mitochondrial function?

MT-ND3 (mitochondrial NADH-ubiquinone oxidoreductase chain 3) is a critical subunit of Complex I, the first enzyme of the mitochondrial respiratory electron transport chain. This protein is encoded by the mitochondrial genome and contributes to the assembly and function of Complex I, which catalyzes NADH oxidation coupled to ubiquinone reduction. This process is fundamental for generating the proton motive force across the inner mitochondrial membrane that drives ATP synthesis .

In functional studies, MT-ND3 has been shown to significantly impact Complex I assembly, as deficiencies in this protein lead to reduced protein levels, impaired complex assembly, and decreased ATP production . The amino acid sequence typically consists of approximately 115 amino acids, as observed in species like Elephas maximus, forming a hydrophobic protein integrated into the inner mitochondrial membrane .

How can researchers express recombinant MT-ND3 protein in laboratory settings?

Expression Systems and Optimization Strategies:

Expression SystemAdvantagesChallengesOptimization Strategies
E. coliHigh yield, cost-effective, rapid growthMembrane protein folding issuesUse of fusion tags (e.g., His-tag), low temperature induction
Mammalian cellsNative post-translational modificationsLower yield, higher costCodon optimization, stable cell line generation
Cell-free systemsAvoids toxicity issuesLimited scaleSupplementation with lipids/detergents

For effective recombinant expression, researchers typically use E. coli systems with fusion tags to facilitate purification. As demonstrated with the Elephas maximus MT-ND3, a full-length protein (1-115 amino acids) fused to an N-terminal His-tag can be successfully expressed in E. coli . When preparing expression constructs for Eligmodontia typus MT-ND3, researchers should consider codon optimization for the expression system of choice, which has been shown to significantly improve yield and functionality of mitochondrial proteins .

What purification methods are most effective for recombinant MT-ND3?

The purification of recombinant MT-ND3 presents challenges due to its hydrophobic nature and membrane association. Based on successful approaches with similar proteins, researchers should consider:

  • Affinity Chromatography: Using His-tagged MT-ND3 allows for initial purification using nickel or cobalt-based affinity resins .

  • Buffer Optimization: Inclusion of appropriate detergents (e.g., DDM, LDAO) in purification buffers helps maintain protein solubility.

  • Storage Conditions: After purification, lyophilization has proven effective, with recommended storage at -20°C/-80°C. Repeated freeze-thaw cycles should be avoided to maintain protein integrity .

For reconstitution, researchers should centrifuge the vial briefly before opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of 5-50% glycerol (final concentration) is recommended for long-term storage at -20°C/-80°C .

How can researchers assess the functional activity of recombinant MT-ND3 in experimental systems?

Functional assessment of recombinant MT-ND3 requires multiple complementary approaches:

Complex I Activity Assays:

  • NADH:ubiquinone oxidoreductase activity: Measure the rate of NADH oxidation spectrophotometrically at 340 nm in the presence of ubiquinone analogs.

  • Rotenone sensitivity testing: Compare activity before and after rotenone addition to confirm Complex I-specific activity.

  • Electron transfer kinetics: Analyze using stopped-flow techniques to understand reaction mechanisms .

Integration into Mitochondrial Systems:

  • Complementation assays: Introduction of recombinant MT-ND3 into cells with mutant variants to assess rescue of deficient Complex I activity.

  • ATP synthesis measurements: Quantification of ATP production rates in complemented systems compared to controls.

  • Respiratory chain flux analysis: Oxygen consumption measurements using respirometry .

Studies have shown that functional analysis of MT-ND3 variants (such as m.10197G > C) reveals decreased MT-ND3 protein levels, impaired complex I assembly and activity, and reduced ATP synthesis, providing a benchmark for comparisons with wild-type protein function .

What experimental approaches can be used to investigate MT-ND3 interactions with other Complex I subunits?

Understanding MT-ND3's interactions with other Complex I components requires multiple structural and functional approaches:

  • Cross-linking studies: Chemical cross-linking followed by mass spectrometry (XL-MS) to identify interaction partners.

  • Co-immunoprecipitation: Using antibodies against MT-ND3 or potential partner proteins to identify interacting components.

  • Blue Native PAGE: Analysis of Complex I assembly intermediates to determine the stage at which MT-ND3 is incorporated.

  • Cryo-EM structural analysis: High-resolution structural determination to visualize MT-ND3's position within the complex.

  • Site-directed mutagenesis: Introduction of specific mutations to disrupt potential interaction sites and assess functional consequences.

How do MT-ND3 sequences vary across rodent species, and what are the implications for evolutionary studies?

MT-ND3 sequence variation across rodent species provides valuable insights into evolutionary relationships and adaptation:

Comparative Analysis of MT-ND3 Across Selected Rodent Species:

SpeciesSequence Identity to E. typusKey Amino Acid DifferencesFunctional Implications
Eligmodontia typus100%Reference sequenceBaseline function
Related sigmodontine rodents90-95% (estimated)Variations in transmembrane domainsPotential adaptations to metabolic requirements
Bibimys species85-90% (estimated)Variations in functional domainsReflects phylogenetic relationships within Sigmodontinae
Ctenomys species80-85% (estimated)More substantial variationsDivergence reflecting longer evolutionary separation

The study of MT-ND3 sequences can contribute to phylogenetic analyses of rodent evolution, particularly within the diverse South American sigmodontines . Analysis of MT-ND3 sequence conservation patterns can identify functionally critical residues versus those subject to evolutionary variation, providing insights into structure-function relationships. Mitochondrial gene studies have been instrumental in resolving taxonomic relationships among mammals , with mitochondrial sequence data providing valuable markers for phylogeographic studies.

How can researchers investigate the role of MT-ND3 variants in mitochondrial disease pathogenesis?

Investigating MT-ND3 variants in disease contexts requires sophisticated experimental approaches:

  • Patient-derived cellular models: Fibroblasts or cybrid cells containing MT-ND3 variants allow for direct assessment of pathogenic consequences.

  • CRISPR-based mitochondrial DNA editing: Although challenging, emerging techniques for mtDNA editing can create isogenic cell lines differing only in MT-ND3 sequence.

  • Functional rescue experiments: Introduction of wild-type MT-ND3 through innovative approaches like allotopic expression.

  • Multi-omics analysis: Integration of proteomics, metabolomics, and transcriptomics to characterize cellular responses to MT-ND3 deficiency.

Recent research has identified novel MT-ND3 variants associated with mitochondrial diseases, such as the m.10197G > C variant that causes Leigh syndrome and complex I deficiency . Functional analyses have confirmed that this variant significantly lowers MT-ND3 protein levels, causing complex I assembly and activity deficiency, and reduction of ATP synthesis . These findings provide a methodological framework for investigating other MT-ND3 variants of unknown significance.

What innovative approaches can restore function in cells with MT-ND3 mutations?

Recent advances have demonstrated promising strategies for functional rescue:

Allotopic Expression through Codon Optimization:
Researchers have successfully developed a technique for delivering mitochondrial genes into mitochondria through codon optimization for nuclear expression and translation by cytoplasmic ribosomes . This approach involves:

  • Codon optimization: Adapting the mitochondrial gene sequence for efficient nuclear expression.

  • Addition of mitochondrial targeting sequences: Enabling import of the translated protein into mitochondria.

  • Expression from nuclear plasmids: Transfection of cells with the optimized construct.

This methodology has been successfully applied to rescue defects arising from MT-ND3 variants, including m.10197G > C and m.10191T > C missense variants . When applied to patient cells, this approach partially restored:

  • MT-ND3 protein levels

  • Complex I assembly and activity

  • ATP production

This innovative technique represents a potential therapeutic strategy for mitochondrial diseases caused by MT-ND3 mutations .

How does MT-ND3 contribute to transhydrogenation reactions, and what are the metabolic implications?

Complex I, which includes MT-ND3, not only catalyzes NADH oxidation coupled to ubiquinone reduction but also facilitates transhydrogenation reactions between different nicotinamide nucleotides:

  • Transhydrogenation mechanism: Complex I can catalyze hydride transfers from reduced to oxidized nicotinamide nucleotides, including NADPH oxidation and NAD+ reduction .

  • Kinetic mechanism: Detailed studies have shown that these reactions follow a ping-pong mechanism with double substrate inhibition, suggesting a single functional nucleotide binding site .

  • Substrate specificity: Complex I demonstrates strong specificity for NADH over NADPH, limiting significant transhydrogenation in physiological conditions .

Metabolic Implications:

  • Under normal conditions, the strong preference for NADH prevents significant transhydrogenation, which would create an energetically wasteful cycle .

  • Some physiological NADPH-ubiquinone oxidoreduction likely occurs but is tolerated or compensated for .

  • These relationships are critical for maintaining appropriate NADPH/NADH ratios, which influence redox balance and numerous cellular processes.

What are the key considerations for designing experiments to compare wild-type and variant forms of MT-ND3?

When designing comparative studies of wild-type and variant MT-ND3 proteins, researchers should consider:

Experimental Design Framework:

Design ElementConsiderationsRecommendations
Expression systemConsistent expression conditionsUse identical vectors, host strains, and expression conditions
Purification methodComparable yield and purityUse parallel purification protocols with appropriate controls
Activity assaysSensitive to detect subtle differencesInclude multiple complementary assays
Stability assessmentDifferential protein stabilityInclude thermal shift assays and limited proteolysis
ControlsAppropriate benchmarkingInclude known functional and non-functional variants

Recent studies comparing wild-type MT-ND3 with disease-associated variants (e.g., m.10197G > C) have employed multiple analytical approaches, measuring protein levels, complex I assembly and activity, and ATP synthesis rates . Such multi-parameter assessment provides comprehensive characterization of variant impact on function.

How should researchers approach the structural analysis of MT-ND3 given its hydrophobic nature?

Structural characterization of membrane proteins like MT-ND3 presents unique challenges:

  • Sample preparation approaches:

    • Detergent solubilization with screening for optimal detergent types

    • Nanodiscs or amphipols for maintaining native-like lipid environments

    • Selective deuteration for neutron scattering or NMR studies

  • Structural determination methods:

    • X-ray crystallography (challenging for individual membrane protein subunits)

    • Cryo-electron microscopy (particularly effective for entire Complex I)

    • Nuclear magnetic resonance for dynamic studies of specific domains

    • Molecular dynamics simulations to predict structure and dynamics

  • Functional correlation:

    • Site-directed mutagenesis of predicted structural elements

    • EPR spectroscopy to examine electron transfer properties

    • Cross-linking mass spectrometry to map intramolecular and intermolecular interactions

Researchers must consider that MT-ND3's native environment is within the complex architecture of Complex I, and its structure may differ when isolated versus integrated into the complex.

What quality control methods ensure the functionality of recombinant MT-ND3 preparations?

Ensuring the quality and functionality of recombinant MT-ND3 preparations requires rigorous testing:

Essential Quality Control Parameters:

  • Purity assessment:

    • SDS-PAGE analysis (typically aiming for >90% purity)

    • Mass spectrometry for precise molecular weight confirmation

    • Western blotting with specific antibodies

  • Structural integrity verification:

    • Circular dichroism spectroscopy to assess secondary structure

    • Fluorescence spectroscopy to evaluate tertiary structure

    • Thermal stability assays to determine protein folding quality

  • Functional testing:

    • NADH oxidation activity in reconstituted systems

    • Incorporation into Complex I assembly assays

    • Electron transfer capacity measurements

  • Storage stability monitoring:

    • Activity retention after freeze-thaw cycles

    • Long-term stability at recommended storage conditions (-20°C/-80°C)

    • Effects of buffer components (e.g., glycerol concentration)

For recombinant MT-ND3, specifically recommended storage conditions include lyophilized powder form, avoiding repeated freeze-thaw cycles, and storing working aliquots at 4°C for up to one week . Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with glycerol addition (typically 50%) for long-term storage .

How can researchers accurately quantify complex I activity in systems with recombinant MT-ND3?

Accurate quantification of Complex I activity requires careful methodological considerations:

  • Spectrophotometric NADH oxidation assays:

    • Monitor NADH decrease at 340 nm

    • Include rotenone controls to distinguish Complex I-specific activity

    • Calculate rates accounting for extinction coefficient and path length

  • Oxygen consumption measurements:

    • High-resolution respirometry to measure integrated function

    • Sequential substrate-inhibitor titration protocols

    • Analysis of respiratory control ratios

  • Data normalization approaches:

    • Protein concentration determination using multiple methods

    • Mitochondrial content markers for cellular systems

    • Internal standards for comparative analyses

  • Statistical analysis considerations:

    • Appropriate replication (typically n ≥ 3)

    • Testing for normality of data distribution

    • Selection of parametric or non-parametric tests based on data characteristics

When analyzing Complex I activity data, researchers should account for substrate availability, enzyme concentration, temperature, pH, and the presence of inhibitors or activators. Michaelis-Menten kinetic analysis can provide valuable parameters (Km, Vmax) for comparing wild-type and variant forms .

What bioinformatic approaches can predict the impact of MT-ND3 sequence variations?

Computational prediction of MT-ND3 variant effects employs multiple complementary approaches:

  • Sequence conservation analysis:

    • Multiple sequence alignment across species

    • Calculation of conservation scores

    • Identification of evolutionarily constrained residues

  • Structural impact prediction:

    • Homology modeling of MT-ND3 within Complex I

    • Molecular dynamics simulations of variant effects

    • Energy minimization calculations

  • Machine learning approaches:

    • Training on known pathogenic variants

    • Feature extraction from sequence and structural data

    • Classification of variants of unknown significance

  • Integration with experimental data:

    • Correlation of predictions with biochemical measurements

    • Refinement of models based on functional data

    • Development of composite prediction scores

Bioinformatic predictions should be validated through experimental approaches, as demonstrated in studies of novel MT-ND3 variants like m.10197G > C, where computational predictions were confirmed through functional analyses showing decreased protein levels and complex I deficiency .

How do transhydrogenation reactions influence experimental design and data interpretation?

The complex I-mediated transhydrogenation between nicotinamide nucleotides introduces important considerations for experimental design:

  • Reaction mechanism considerations:

    • Ping-pong mechanism with double substrate inhibition governs these reactions

    • Single nucleotide binding site participates in both half-reactions

    • Productive states form when nucleotide and active-site flavin have complementary oxidation states

  • Substrate competition effects:

    • NADH strongly outcompetes NADPH for the complex I active site

    • Less than 0.2% of dehydrogenation reactions are attributed to NADPH under typical conditions

    • NAD+ and NADP+ compete with ubiquinone for reduced flavin electrons

  • Experimental design implications:

    • Control nucleotide ratios carefully in activity assays

    • Account for competing reactions in kinetic analyses

    • Consider the influence of nucleotide binding on other Complex I functions

  • Physiological relevance assessment:

    • Evaluate whether observed transhydrogenation is relevant in vivo

    • Consider cellular NAD+/NADH and NADP+/NADPH ratios

    • Account for competing enzymes like dedicated transhydrogenases

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.