Recombinant Elusimicrobium minutum ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant atpB is typically expressed in Escherichia coli and purified using affinity chromatography. Key parameters include:

ParameterDetails
Expression SystemE. coli
Purity>85% (SDS-PAGE)
StorageTris-based buffer with 50% glycerol; stable at -20°C/-80°C
ApplicationsWestern blot (WB), ELISA

Research Applications and Limitations

Current Uses:

  • Antibody Production: Recombinant atpB serves as an antigen for polyclonal antibody development .

  • Enzyme Mechanism Studies: Used to probe F₀ domain functionality in E. minutum’s unique fermentative metabolism .

Limitations:

  • Partial Sequence: The recombinant protein lacks full-length structural domains, limiting functional studies .

  • Uncharacterized Interactions: The role of atpB in E. minutum’s ATP synthase remains inferred from homologs like Mycobacterium F-ATP synthase .

Genomic and Metabolic Context

E. minutum’s genome (1.64 Mbp) encodes a complete F-type ATP synthase complex, consistent with its reliance on substrate-level phosphorylation and hydrogenase-coupled fermentation . Key annotations include:

  • Fermentation Pathways: Embden-Meyerhof glycolysis coupled to acetate, ethanol, and hydrogen production .

  • Bioenergetic Constraints: Obligate anaerobiosis necessitates tight regulation of proton motive force, where atpB’s role is pivotal .

Future Research Directions

  • Structural Resolution: Cryo-EM or X-ray crystallography to map atpB’s transmembrane topology.

  • Functional Mutagenesis: Deletion studies to clarify its role in ATP synthase latency, drawing parallels to mycobacterial αCTD regulatory mechanisms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have specific requirements for the format, please indicate your preferences when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; Emin_1515; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-248
Protein Length
full length protein
Species
Elusimicrobium minutum (strain Pei191)
Target Names
atpB
Target Protein Sequence
MIEEILTHHIIDHKLTYKLFGVIPLSSNLITLFCITIGVFILFTLIAKFRRPVLLMTAIE GLVVFIRDEIVVANFGEHGKKLTPYFCTLFIFLLFSNSLGMIPQMRTITGSISVTIGMAL TSLSLIIFLGVKQNGLLGYLKHFVPEGTPWFLAPLLFFLEILGLFTKTAALALRLFANMI AGHMVIICFICLIFIMTAINKYAGIFTAIPSTGLSLFVNLLEVLVILIQTYVFTLLTAIF AGEAYAHH
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel and plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Elusimicrobium minutum and why is its ATP synthase subunit a significant?

Elusimicrobium minutum is the first cultured representative of the Elusimicrobia phylum (formerly known as Termite Group 1). It is a strictly anaerobic bacterium originally isolated from a beetle larva gut, with a completely sequenced genome of approximately 1.64 Mbp . The ATP synthase subunit a (atpB) is particularly significant because it functions in the F0 sector of ATP synthase, which is crucial for energy metabolism in this organism. This protein plays a key role in the proton-motive force that drives ATP synthesis/hydrolysis . For researchers, this protein offers insights into energy conservation mechanisms in phylogenetically distinct anaerobes and potentially novel structural adaptations for function in anaerobic environments.

What expression systems are recommended for producing recombinant E. minutum ATP synthase subunit a?

For recombinant production of E. minutum ATP synthase subunit a (atpB), an in vitro E. coli expression system has been successfully employed . This approach is particularly suitable because:

  • E. coli systems provide high yield and reproducibility for membrane protein expression

  • The system allows for the incorporation of the N-terminal 10xHis-tag for simplified purification

  • The in vitro system helps overcome potential toxicity issues that might arise from overexpression of membrane proteins in living cells

When establishing an expression protocol, researchers should consider these methodological approaches:

  • Use of specialized E. coli strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3), or Lemo21(DE3))

  • Induction at lower temperatures (16-18°C) to improve proper folding

  • Addition of specific detergents during lysis and purification to maintain protein solubility

  • Optimization of buffer conditions to preserve protein stability throughout the purification process

What are the optimal storage conditions for recombinant E. minutum ATP synthase subunit a?

For optimal stability and retention of function, recombinant E. minutum ATP synthase subunit a should be stored at -20°C, and for extended storage, conservation at -20°C or -80°C is recommended . Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing should be avoided as this can lead to protein denaturation and loss of activity .

The shelf life varies depending on storage conditions and formulation:

  • Liquid form: approximately 6 months at -20°C/-80°C

  • Lyophilized form: approximately 12 months at -20°C/-80°C

Factors affecting shelf life include buffer composition, storage temperature, and the intrinsic stability of the protein itself. For research requiring long-term use, preparing smaller aliquots to avoid freeze-thaw cycles is advisable.

How does E. minutum ATP synthase function within the context of anaerobic metabolism?

E. minutum is a strictly anaerobic bacterium with a specialized metabolism adapted to its ecological niche. Its ATP synthase plays a critical role in energy conservation through a sophisticated interplay with other metabolic systems. Based on genomic analysis, E. minutum possesses all genes required for uptake and fermentation of sugars via the Embden-Meyerhof pathway, including several hydrogenases .

The ATP synthase functions within this metabolic framework through:

  • Integration with the proton-motive force: The ATP synthase is coupled to the proton-motive force for ATP synthesis/hydrolysis .

  • Coordination with fermentation pathways: E. minutum exhibits an unusual peptide degradation pathway comprising transamination reactions leading to alanine formation, which is excreted in substantial amounts .

  • Adaptation to energy limitation: The protein likely has structural adaptations for optimal function under the energy-limited conditions typical in anaerobic environments.

For methodological investigation of these functions, researchers should consider:

What considerations are important when using the recombinant His-tagged E. minutum ATP synthase subunit a for structural studies?

When conducting structural studies with the recombinant His-tagged E. minutum ATP synthase subunit a, several methodological considerations are crucial:

  • Tag interference assessment: The N-terminal 10xHis-tag may influence protein folding, oligomerization, or crystal packing. Researchers should:

    • Compare activity of tagged versus untagged protein (using tag cleavage if necessary)

    • Assess whether the tag affects protein-protein interactions with other ATP synthase subunits

    • Consider tag position alternatives (C-terminal vs. N-terminal) if interference is observed

  • Membrane protein crystallization challenges: As a transmembrane protein , crystallization requires specialized approaches:

    • Selection of appropriate detergents for solubilization

    • Use of lipidic cubic phase crystallization methods

    • Application of bicelle or nanodisc technologies to maintain native-like membrane environment

    • Consideration of cryo-EM as an alternative to crystallography

  • Structural comparison framework: Analysis should include comparison with ATP synthase subunits from better-characterized organisms to identify unique features related to anaerobic adaptation.

How can protein-protein interaction studies be optimized for investigating E. minutum ATP synthase subunit a associations?

ATP synthase subunit a (atpB) functions as part of a larger complex, making protein-protein interaction studies essential for understanding its functional context. Methodological approaches for such studies include:

  • Co-immunoprecipitation optimization:

    • Utilize the N-terminal 10xHis-tag for pulldown assays

    • Develop gentle solubilization protocols to maintain native interactions

    • Cross-link proteins prior to cell disruption to capture transient interactions

  • Bacterial two-hybrid systems:

    • Adapt membrane-specific bacterial two-hybrid assays for transmembrane protein analysis

    • Design constructs that properly expose interaction domains while maintaining membrane anchoring

    • Include appropriate controls that account for the hydrophobic nature of membrane proteins

  • In situ proximity labeling:

    • Employ BioID or APEX2 fusion constructs for labeling proteins in proximity to ATP synthase subunit a

    • Optimize expression conditions to ensure proper localization of fusion proteins

    • Use quantitative proteomics to identify labeled proteins

These approaches should be designed with consideration of E. minutum's unique biochemical properties as a strictly anaerobic bacterium with a Gram-negative cell envelope .

What experimental design considerations are important when studying the functional impacts of post-translational modifications on E. minutum ATP synthase subunit a?

Post-translational modifications (PTMs) potentially play significant roles in regulating ATP synthase function in response to changing environmental conditions. When designing experiments to investigate these modifications, researchers should consider:

  • PTM identification strategy:

    • Mass spectrometry analysis of purified recombinant protein compared to native protein

    • Enrichment techniques specific to different modification types (phosphorylation, acetylation, etc.)

    • Site-specific antibodies for common modifications if available

  • Functional correlation studies:

    • Site-directed mutagenesis of potential modification sites to mimic or prevent modifications

    • Activity assays under different environmental conditions that might trigger modifications

    • Comparative analysis with other bacterial ATP synthases with known regulatory modifications

  • Temporal aspects of modifications:

    • Time-course experiments during different growth phases

    • Analysis of modification patterns during transitions between metabolic states

    • Correlation of modifications with changes in ATP synthesis rates

While specific PTM data for E. minutum ATP synthase is limited, these approaches provide a framework for investigating this important aspect of protein regulation in this phylogenetically distinct bacterium.

What purification strategies yield the highest purity and activity for recombinant E. minutum ATP synthase subunit a?

Purification of recombinant E. minutum ATP synthase subunit a requires specialized approaches due to its transmembrane nature. The following methodological pipeline has proven effective:

  • Initial capture:

    • Immobilized metal affinity chromatography (IMAC) using the N-terminal 10xHis-tag

    • Careful selection of detergents to maintain protein solubility without denaturing

    • Inclusion of protease inhibitors to prevent degradation

  • Secondary purification:

    • Size exclusion chromatography to separate monomeric from aggregated protein

    • Ion exchange chromatography as needed for removal of remaining contaminants

    • Detergent exchange if necessary for downstream applications

  • Quality control assessments:

    • SDS-PAGE and western blotting to confirm identity and purity

    • Mass spectrometry to verify intact protein mass

    • Circular dichroism to assess secondary structure integrity

When implementing these methods, researchers should carefully monitor protein activity throughout the purification process to ensure that function is preserved.

How can researchers effectively troubleshoot expression challenges with E. minutum ATP synthase subunit a?

Common challenges in heterologous expression of membrane proteins like E. minutum ATP synthase subunit a include poor expression, inclusion body formation, and toxicity to host cells. Methodological approaches to troubleshoot these issues include:

ChallengeTroubleshooting ApproachImplementation Details
Poor expressionExpression vector optimizationTest different promoters, codon optimization for E. coli
Host strain screeningEvaluate specialized strains like C41(DE3), C43(DE3), Lemo21(DE3)
Induction conditionsVary IPTG concentration, induction temperature, and duration
Inclusion body formationSolubilization agentsScreen different detergents and chaotropic agents
Refolding protocolsDevelop gradual dilution or dialysis protocols for refolding
Fusion partnersTest solubility-enhancing fusion tags (MBP, SUMO, etc.)
Host toxicityControlled expressionUse tightly regulated promoters or auto-induction media
Membrane integrityMonitor cell growth and morphology during induction
Growth media adjustmentOptimize media composition to counterbalance metabolic burden

Researchers should implement a systematic screening approach, testing multiple conditions in parallel to identify optimal expression parameters for this challenging transmembrane protein.

How can structural insights from E. minutum ATP synthase subunit a inform drug discovery targeting bacterial energy metabolism?

The unique phylogenetic position of Elusimicrobium minutum as the first cultivated representative of the Elusimicrobia phylum makes its ATP synthase subunit a valuable for comparative studies that could inform novel antimicrobial development. Methodological frameworks for utilizing this structural information include:

  • Structural divergence analysis:

    • Identify regions unique to E. minutum ATP synthase compared to human homologs

    • Map conservation patterns across bacterial phyla to find universally conserved motifs

    • Use molecular dynamics simulations to understand functional implications of structural differences

  • Binding site characterization:

    • In silico docking studies to identify potential inhibitor binding pockets

    • Fragment-based screening using purified recombinant protein

    • Structure-activity relationship studies with known ATP synthase inhibitors

  • Translational applications:

    • Design of broad-spectrum inhibitors targeting conserved regions

    • Development of narrow-spectrum agents exploiting unique structural features

    • Creation of molecular probes for studying ATP synthase function

These approaches could lead to novel therapeutics targeting bacterial energy metabolism, addressing the growing challenge of antimicrobial resistance.

What techniques are most effective for investigating the evolutionary adaptation of E. minutum ATP synthase to anaerobic environments?

E. minutum's strict anaerobic lifestyle suggests its ATP synthase may have unique adaptations for function in low-energy environments. To investigate these evolutionary adaptations, researchers should consider:

  • Comparative sequence analysis:

    • Phylogenetic reconstruction across diverse bacterial lineages

    • Identification of amino acid substitutions unique to anaerobic lineages

    • Calculation of selection pressures on different protein domains

  • Ancestral sequence reconstruction:

    • Computational inference of ancestral ATP synthase sequences

    • Expression and characterization of inferred ancestral proteins

    • Functional comparison between ancestral and modern variants

  • Structure-function correlation:

    • Site-directed mutagenesis of residues potentially involved in anaerobic adaptation

    • Functional assays under varying oxygen tensions and redox conditions

    • Electron paramagnetic resonance spectroscopy to detect structural changes under different conditions

These approaches can provide insights into how ATP synthases have evolved to function in diverse environments and may reveal design principles for engineering energy-efficient enzymes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.