Recombinant Elusimicrobium minutum Protein translocase subunit SecF (secF)

Shipped with Ice Packs
In Stock

Description

Genomic Context and Functional Role

E. minutum possesses a variant of the general secretion pathway (GSP) encoded by secADFYEG, lacking the SecB chaperone subunit. Instead, it likely relies on more general chaperones like DnaJ or DnaK for protein folding and targeting . The Sec translocon in E. minutum is essential for exporting proteins with signal peptides, which constitute ~40% of its proteome .

Key Features of the E. minutum Sec System:

ComponentDescription
Sec TransloconEncodes secADFYEG; lacks SecB; utilizes DnaJ/DnaK for targeting .
Secreted Proteins~40% of proteome; includes proteins in COG category U (intracellular trafficking) .
Type II Secretion System (T2SS)Partially annotated; missing critical components (e.g., gspL, gspM) .

Functional Insights from Genomic Analysis

Genomic studies reveal that E. minutum employs SecF as part of a modified Sec translocon. Critical findings include:

  • Chaperone Adaptation: Absence of SecB necessitates reliance on DnaJ/DnaK for pre-protein targeting .

  • Secretion Efficiency: High prevalence of signal peptides in E. minutum highlights SecF’s role in export .

  • Phylogenetic Distinction: Comparative analysis of 22 single-copy markers confirms Elusimicrobia as a distinct phylum, with SecF contributing to its unique metabolic and secretion profiles .

Research Applications and Production

Recombinant SecF is primarily used in biochemical and immunological studies. Key applications include:

  • ELISA and Antibody Development: Used as an antigen for generating specific antibodies .

  • Protein-Protein Interaction Studies: Investigates interactions with SecA, D, E, G, and other translocon components .

  • Membrane Protein Research: Serves as a model for studying translocation mechanisms in Gram-negative bacteria.

Table 2: Production and Handling Guidelines

ParameterDescription
Expression HostE. coli
PurificationStandard His-tag affinity chromatography .
StabilityAvoid repeated freeze-thaw cycles; store at -20°C .

Comparative Analysis with Other Organisms

While SecF is conserved across bacteria, E. minutum’s variant system offers unique insights:

  • SecB Absence: Unlike E. coli, E. minutum lacks SecB, suggesting alternative folding strategies .

  • T2SS Complexity: Partial T2SS annotation contrasts with robust Sec translocon functionality, emphasizing SecF’s importance in primary secretion .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery times.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
secF; Emin_0562; Protein translocase subunit SecF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-321
Protein Length
full length protein
Species
Elusimicrobium minutum (strain Pei191)
Target Names
secF
Target Protein Sequence
MMNLIPKTNFDFLKIRKYFYAVSAIILIAGLICILTRGLNMGIDFKGGTMVQVQFTESIT IDQVRSAVEKYNPEIQSYVGKNTYMIKIKGSQENVNEVRSDVETSLTAAKLKFTVVATDF VGPTVGKDLGERALWALALSLVFMVLYIAFRFQNIIWGTAGVIALIHDAFFMVAAFAFLQ KEFDLVIVAALLTAVGYSINDNIVIFDRMRENIKENPKESFYNIVNRSLNETLSRTVITG STVLIVLVIIYFFGGEVLKNFSLIMLIGVIVGTYSTLFIATPIVYDWAKDSDNFAKTVGN QDVALAAEIKTAKKHNKKKHR
Uniprot No.

Target Background

Function
SecF is a component of the Sec protein translocase complex, interacting with the SecYEG preprotein conducting channel. It utilizes the proton motive force (PMF) to complete protein translocation after the ATP-dependent function of SecA.
Database Links
Protein Families
SecD/SecF family, SecF subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Elusimicrobium minutum and why is its SecF protein of research interest?

Elusimicrobium minutum is the first cultured representative of the Elusimicrobia phylum (formerly termite group 1 or TG1). It is a strictly anaerobic bacterium with a relatively small circular chromosome of 1,643,562 bp and an average G+C content of 39.0 mol% . Its importance stems from its unique phylogenetic position and specialized adaptations to intestinal environments.

The SecF protein, as part of the Sec translocon (encoded by secADFYEG), is critical for protein secretion in E. minutum . What makes this secretion system particularly interesting is that it lacks a SecB subunit, which is typically present in other bacteria. In E. minutum, the SecB function is likely replaced by more general chaperones such as DnaJ or DnaK . Studying this unique variant of the Sec translocon can provide insights into alternative secretion mechanisms and protein transport across membranes.

What is known about the genomic organization of secF and the Sec translocon genes in E. minutum?

The secF gene in E. minutum appears within the genome as part of the Sec translocon gene cluster. Based on the genome annotation, E. minutum possesses the genes secA, secD, secF, secY, secE, and secG, which encode the core components of the Sec translocon . The genome contains 1,597 predicted genes total, of which 1,529 (95.7%) code for proteins .

The gene organization reflects the functionality of the Sec translocon, with secF likely forming an operon with other sec genes. This arrangement is consistent with the coordinated expression of components that function together in the protein translocation process. The absence of the secB gene in this genomic organization highlights the unique adaptation of E. minutum's secretion system.

What are the general approaches for expressing recombinant E. minutum SecF protein?

When expressing recombinant E. minutum SecF protein, researchers should consider several methodological approaches:

  • Expression system selection: Due to the strictly anaerobic nature of E. minutum, expressing its membrane proteins in aerobic hosts like E. coli may require optimization. Consider using specialized E. coli strains designed for membrane protein expression, such as C41(DE3) or C43(DE3).

  • Vector design: Incorporate affinity tags (His, GST, etc.) for purification while ensuring they don't interfere with protein folding. Position tags at either the N- or C-terminus based on predicted topology.

  • Codon optimization: Adapt the E. minutum secF sequence to the codon usage of the expression host to improve translation efficiency.

  • Induction conditions: Test various induction temperatures (typically lower temperatures of 16-25°C improve membrane protein folding) and inducer concentrations.

  • Membrane extraction: Use appropriate detergents (DDM, LDAO, etc.) for solubilization and purification of the membrane-integrated SecF protein.

These approaches should be systematically tested and optimized for the specific research application.

How can researchers verify the proper folding and functionality of recombinant E. minutum SecF?

Verifying proper folding and functionality of recombinant SecF requires multiple analytical techniques:

  • Circular dichroism (CD) spectroscopy: Assess secondary structure content to confirm proper protein folding.

  • Limited proteolysis: Correctly folded proteins typically show resistance to proteolytic digestion compared to misfolded variants.

  • Size exclusion chromatography: Analyze the oligomeric state and homogeneity of the purified protein.

  • ATPase activity assays: While SecF itself doesn't have ATPase activity, its influence on the ATPase activity of SecA can be measured when reconstituted with other Sec components.

  • Reconstitution experiments: Incorporate purified SecF into liposomes along with other Sec components to assess translocation activity using model substrates.

  • Binding assays: Evaluate interactions with other components of the Sec machinery using techniques such as surface plasmon resonance or microscale thermophoresis.

A comprehensive evaluation using multiple techniques provides the most reliable assessment of recombinant SecF quality.

What is the predicted structure of E. minutum SecF based on genomic and comparative analyses?

Based on comparative analysis with SecF proteins from other bacterial species, E. minutum SecF is predicted to be an integral membrane protein with multiple transmembrane domains. The protein would likely contain cytoplasmic and periplasmic domains that interact with other components of the Sec translocon.

The genome analysis reveals that E. minutum possesses a general secretion pathway with the Sec translocon, but with notable differences from canonical systems . These structural distinctions may reflect adaptations to the specific environmental niche of E. minutum and its strictly anaerobic lifestyle.

Tertiary structure prediction would require computational modeling based on homology with crystallized SecF proteins from other organisms, as no experimental structure for E. minutum SecF is currently available in the search results.

How does the absence of SecB in E. minutum affect the function of SecF and the entire Sec translocon?

The absence of SecB in E. minutum represents a significant deviation from the canonical Sec translocon system and likely has profound implications for SecF function:

  • Altered chaperone interactions: In E. minutum, the SecB function is likely compensated by general chaperones like DnaJ or DnaK . This substitution may require specialized interactions between these chaperones and SecF that differ from typical SecB-SecF interactions.

  • Modified substrate delivery mechanism: SecB typically delivers unfolded preproteins to SecA. Without SecB, the pathway for substrate delivery to SecF and other translocon components must follow alternative routes, potentially involving direct DnaK/DnaJ-mediated delivery.

  • Impact on secretion efficiency: The efficiency of protein translocation may be affected, possibly requiring compensatory adaptations in SecF structure or function to maintain adequate secretion capacity.

  • Experimental approaches to study this phenomenon:

    • Generate chimeric systems where E. minutum SecF is expressed in model organisms with and without their native SecB

    • Compare protein translocation efficiency between wild-type and reconstituted systems

    • Use proteomics to identify alternative protein interactions in the absence of SecB

Understanding these adaptations can provide insights into the flexibility and evolutionary adaptability of bacterial secretion systems.

What experimental approaches can be used to study the interaction network of SecF within the E. minutum secretion pathway?

Several sophisticated experimental approaches can elucidate the interaction network of SecF:

  • Chemical cross-linking coupled with mass spectrometry: This approach can capture transient protein-protein interactions. Cross-linkers of varying lengths can map spatial relationships between SecF and its partners.

  • Bacterial two-hybrid or split-GFP assays: These methods can validate direct protein-protein interactions between SecF and other components of the secretion machinery.

  • Co-immunoprecipitation followed by proteomics: This approach can identify novel interaction partners of SecF in native or heterologous expression systems.

  • Site-specific photocrosslinking: By incorporating photoreactive amino acids at specific positions within SecF, researchers can map interaction interfaces with high precision.

  • Single-molecule FRET analysis: This technique can measure distances between labeled components and detect conformational changes during the translocation process.

  • Cryo-electron microscopy: This method can visualize the entire Sec translocon complex, including SecF, at near-atomic resolution.

When designing interaction studies, researchers should consider the unique aspects of E. minutum's secretion system, particularly the absence of SecB and possible compensatory mechanisms involving general chaperones like DnaJ and DnaK .

How can site-directed mutagenesis of E. minutum SecF advance our understanding of bacterial protein translocation?

Site-directed mutagenesis of E. minutum SecF provides a powerful approach to dissect structure-function relationships:

  • Transmembrane domain mutations: Alterations in membrane-spanning regions can reveal residues critical for channel formation and protein integration.

  • Periplasmic loop mutations: Modifications in periplasmic domains may affect interactions with SecD and other components, providing insights into complex assembly.

  • Conserved residue substitutions: Mutating residues conserved across bacterial species can identify universally important functional elements.

  • Charge reversal mutations: Altering charged residues can disrupt electrostatic interactions critical for protein translocation.

  • Cysteine scanning mutagenesis: Introducing cysteines at specific positions allows for targeted chemical modification and crosslinking experiments.

Experimental validation methods should include:

  • Complementation assays in conditional sec mutants

  • In vitro translocation assays with reconstituted systems

  • Monitoring of protein-protein interactions after mutation

  • Assessing impacts on SecA ATPase stimulation

This mutagenesis approach is particularly valuable for E. minutum SecF due to its unique context in a secretion system lacking SecB, potentially revealing specialized adaptations in this unusual bacterium.

What challenges exist in reconstituting a functional E. minutum Sec translocon in vitro for mechanistic studies?

Reconstituting a functional E. minutum Sec translocon presents several methodological challenges:

  • Expression and purification obstacles:

    • Membrane proteins like SecF are notoriously difficult to express and purify in functional form

    • The strictly anaerobic nature of E. minutum may require expression under oxygen-limited conditions

    • Complex membrane integration requirements may necessitate specialized expression systems

  • Component coordination challenges:

    • The Sec translocon comprises multiple proteins (SecA, SecD, SecF, SecY, SecE, and SecG) that must be co-purified or individually purified and then assembled

    • Stoichiometric assembly of components requires careful titration

    • Lack of SecB necessitates incorporation of alternative chaperones (DnaJ/DnaK)

  • Reconstitution methodology:

    • Selection of appropriate lipids that mimic E. minutum membrane composition

    • Determination of optimal detergent for solubilization and subsequent removal

    • Formation of proteoliposomes with correct protein orientation

  • Functional assessment:

    • Development of translocation assays with appropriate model substrates

    • Real-time monitoring of translocation events

    • Verification of energy coupling (ATP hydrolysis and PMF utilization)

Reconstitution ComponentChallengePotential Solution
SecF and other membrane componentsLow expression yieldsUse specialized expression strains and fusion proteins
Lipid environmentUnknown native compositionTest various lipid mixtures mimicking bacterial membranes
Alternative chaperonesUncertain interaction dynamicsCo-expression of DnaJ/DnaK with Sec components
Energy couplingMaintaining PMF in vitroIncorporate ATP regenerating systems and pH gradients
Functional verificationLack of standardized assaysDevelop fluorescence-based translocation monitoring

These challenges necessitate systematic optimization approaches and may require innovative methodological adaptations.

How might the oxygen stress protection system of E. minutum influence recombinant SecF expression and function?

E. minutum possesses a sophisticated oxygen stress protection system despite being an obligate anaerobe, which has significant implications for recombinant SecF expression and function:

  • Oxidative stress during expression:
    E. minutum contains a six-gene "oxygen stress protection" cluster including ruberythrin (rbr), superoxide reductase (sor), rubredoxin:oxygen oxidoreductase (roo), and rubredoxin (rub) . These proteins help E. minutum manage oxygen exposure, suggesting that recombinant SecF may be sensitive to oxidative conditions when expressed in aerobic systems.

  • Methodological considerations for expression:

    • Expression under microaerobic or anaerobic conditions may improve protein quality

    • Co-expression with E. minutum oxygen detoxification proteins could enhance SecF stability

    • Addition of reducing agents during purification may preserve native conformation

    • Consider using E. coli strains with enhanced capacity for disulfide bond formation control

  • Experimental verification approaches:

    • Compare SecF expressed under different oxygen tensions

    • Assess the impact of oxidation on SecF function using in vitro translocation assays

    • Evaluate the effect of redox conditions on SecF interactions with other Sec components

    • Use mass spectrometry to identify potential oxidation-sensitive residues

  • Functional implications:
    The unique adaptation of E. minutum to survive oxygen exposure while remaining strictly anaerobic suggests potential conformational sensitivity of its membrane proteins to oxidative environments. This may require special handling of recombinant SecF to maintain native structure and function.

Understanding these relationships could provide valuable insights not only for optimizing expression protocols but also for understanding the evolution of secretion systems in anaerobic bacteria that must occasionally contend with oxygen exposure.

What expression systems are optimal for producing functional recombinant E. minutum SecF?

Selecting an appropriate expression system is critical for obtaining functional recombinant SecF from E. minutum:

  • E. coli-based systems:

    • BL21(DE3) derivatives: C41(DE3) and C43(DE3) are specifically engineered for membrane protein expression

    • Lemo21(DE3): Allows tunable expression through rhamnose-controlled lysozyme production

    • Consider co-expression with E. minutum chaperones to compensate for the lack of SecB

  • Expression conditions optimization:

    • Temperature: Lower temperatures (16-20°C) often improve membrane protein folding

    • Induction: Weak induction with low IPTG concentrations (0.1-0.5 mM)

    • Media supplementation: Consider adding specific lipids or membrane-stabilizing agents

  • Alternative expression hosts:

    • Lactococcus lactis: A gram-positive system with advantages for membrane protein expression

    • Cell-free systems: Allow precise control of the expression environment, potentially beneficial for an anaerobic protein

  • Fusion partners to enhance expression:

    • Maltose-binding protein (MBP): Enhances solubility

    • Mistic: Facilitates membrane integration

    • SUMO tag: Improves folding and allows tag removal without remaining amino acids

Expression SystemAdvantagesDisadvantagesBest For
E. coli C41/C43(DE3)Well-established, high yieldsAerobic environmentInitial expression trials
Lemo21(DE3)Tunable expressionRequires optimizationToxic membrane proteins
Cell-free systemsControlled environmentHigher costDifficult-to-express proteins
L. lactisAlternative membrane compositionLower yieldsNative-like membrane integration

The selection should be guided by the specific experimental requirements and downstream applications for the recombinant SecF protein.

How can researchers effectively study the role of E. minutum SecF in the absence of genetic manipulation tools?

Studying E. minutum SecF without established genetic tools requires creative experimental approaches:

  • Heterologous expression and complementation:

    • Express E. minutum SecF in E. coli sec mutants to assess functional complementation

    • Create chimeric proteins combining domains from E. minutum SecF with better-characterized bacterial SecF proteins

    • Test functionality in reconstituted systems with other E. minutum Sec components

  • In vitro reconstitution approaches:

    • Purify recombinant E. minutum SecF along with other Sec translocon components

    • Reconstitute into liposomes for in vitro translocation assays

    • Compare activity with and without SecF to determine its specific contribution

  • Structural and interaction studies:

    • Use purified components for binding assays to map interaction networks

    • Apply structural biology techniques (X-ray crystallography, cryo-EM) to determine SecF structure

    • Perform crosslinking studies to identify neighboring proteins in reconstituted systems

  • Comparative genomics and bioinformatics:

    • Analyze the SecF sequence in context of the E. minutum secretion system

    • Compare with SecF from other organisms to identify unique features

    • Use computational modeling to predict functional regions and generate testable hypotheses

These approaches circumvent the need for direct genetic manipulation of E. minutum while still providing valuable insights into SecF function.

What methods can be used to characterize the integration of recombinant E. minutum SecF into membrane systems?

Characterizing membrane integration of recombinant SecF requires specialized techniques:

  • Biochemical verification methods:

    • Membrane fractionation: Separation of inner and outer membranes followed by immunoblotting

    • Protease protection assays: Determine topology by accessibility to proteases

    • Alkaline extraction: Differentiate between integral and peripheral membrane proteins

  • Biophysical characterization:

    • FTIR spectroscopy: Assess secondary structure in membrane environments

    • Fluorescence spectroscopy: Monitor tryptophan fluorescence in different environments

    • Differential scanning calorimetry: Measure thermal stability in various membrane compositions

  • Advanced microscopy techniques:

    • Freeze-fracture electron microscopy: Visualize protein distribution in membranes

    • Atomic force microscopy: Observe topography of SecF in membrane systems

    • Super-resolution microscopy: Track labeled SecF in cellular contexts

  • Functional integration assessment:

    • Liposome flotation assays: Verify incorporation into lipid bilayers

    • Ion conductance measurements: Assess channel formation if applicable

    • Translocation activity assays: Verify functionality after membrane reconstitution

These techniques provide complementary information about the structural and functional integration of SecF into membrane systems, crucial for understanding its native behavior.

How can researchers analyze the specific adaptations of E. minutum SecF to an anaerobic lifestyle?

Analyzing the anaerobic adaptations of E. minutum SecF requires multidisciplinary approaches:

  • Sequence and structural analysis:

    • Comparative analysis with SecF from aerobic bacteria to identify unique residues

    • Examination of cysteine content and distribution (potential redox sensitivity)

    • Computational modeling to predict residues that might confer oxygen tolerance or sensitivity

  • Biochemical characterization:

    • Activity assays under varying redox conditions

    • Stability assessment in the presence of oxygen versus anaerobic conditions

    • Analysis of post-translational modifications unique to anaerobic proteins

  • Interaction studies:

    • Investigation of SecF interactions with E. minutum's oxygen stress protection system components

    • Analysis of whether general chaperones (DnaJ/DnaK) that replace SecB have anaerobic-specific adaptations

    • Examination of membrane lipid interactions under different oxygen tensions

  • Experimental approaches:

    • Expression and purification under strictly anaerobic conditions

    • Comparison of protein characteristics before and after oxygen exposure

    • Site-directed mutagenesis of residues predicted to be involved in anaerobic adaptation

Understanding these adaptations would provide insights into how essential cellular processes like protein secretion have evolved in organisms adapted to anaerobic niches.

What purification strategies are most effective for isolating recombinant E. minutum SecF while maintaining its native conformation?

Purifying membrane proteins like SecF presents unique challenges requiring specialized approaches:

  • Solubilization optimization:

    • Test multiple detergents (DDM, LDAO, LMNG, etc.) at various concentrations

    • Consider novel solubilization agents like SMALPs (Styrene Maleic Acid Lipid Particles) that extract membrane proteins with their native lipid environment

    • Optimize temperature, pH, and salt conditions during solubilization

  • Affinity purification approaches:

    • Immobilized metal affinity chromatography (IMAC) using His-tagged SecF

    • Anti-FLAG or Strep-tag II affinity for alternative tagging strategies

    • Tandem affinity purification for higher purity

  • Additional purification steps:

    • Size exclusion chromatography to remove aggregates and ensure homogeneity

    • Ion exchange chromatography for removing contaminating proteins

    • Affinity chromatography targeting interaction partners to isolate functional complexes

  • Stability considerations:

    • Addition of specific lipids to maintain native-like environment

    • Glycerol or other stabilizing agents to prevent denaturation

    • Consider oxygen-free purification given E. minutum's anaerobic nature

Purification StageChallengeOptimized Solution
Membrane extractionMaintaining native foldingGentle cell disruption, avoid heating
SolubilizationDetergent selectionSystematic screening of detergent panel
Affinity purificationTag interferenceC-terminal tags or cleavable tags
Quality assessmentOligomeric state validationMulti-angle light scattering analysis
StorageLong-term stabilityFlash freezing in small aliquots with stabilizers

The purification protocol should be tailored to the specific downstream applications while prioritizing the maintenance of native SecF conformation.

How can researchers overcome the challenge of low expression yields when producing recombinant E. minutum SecF?

Low expression yields are common with membrane proteins like SecF and can be addressed through multiple strategies:

  • Expression vector optimization:

    • Codon optimization for the expression host

    • Use of strong and tunable promoters (T7, tac, ara)

    • Incorporation of enhancer elements and optimal ribosome binding sites

    • Consider larger-scale approaches like fermentation for bulk production

  • Host strain engineering:

    • Use of specialized strains like C41(DE3) with adaptations for membrane protein expression

    • Co-expression of rare tRNAs for non-standard codon usage

    • Modification of chaperone levels to assist proper folding

    • Knockout of proteases that may degrade the target protein

  • Fusion partner strategies:

    • N-terminal fusions with highly expressed proteins (MBP, GST, SUMO)

    • Addition of signal sequences to direct membrane targeting

    • Use of specialized membrane protein fusion partners like Mistic or YidC

  • Expression condition optimization:

    • Temperature reduction (16-20°C) during induction phase

    • Extended expression periods (24-72 hours)

    • Induction at specific growth phases (mid-log vs. late-log)

    • Media supplementation with membrane components or precursors

  • High-throughput optimization:

    • Parallel testing of multiple constructs with varying tags and boundaries

    • Systematic screening of expression conditions using factorial design

    • Fluorescent reporter fusions to rapidly assess expression levels

These approaches should be systematically evaluated and often combined to achieve optimal expression yields for downstream applications.

What strategies can be employed to stabilize E. minutum SecF for structural and functional studies?

Stabilizing SecF for structural and functional studies requires multiple complementary approaches:

  • Buffer optimization:

    • Systematic screening of pH conditions (typically pH 7.0-8.0)

    • Varied salt concentrations (100-500 mM) and types (NaCl, KCl)

    • Addition of stabilizing agents (glycerol 5-20%, sucrose, trehalose)

    • Inclusion of reducing agents (DTT, TCEP) to prevent oxidation

  • Lipid and detergent considerations:

    • Addition of specific lipids to mimic native membrane environment

    • Testing of detergent mixtures rather than single detergents

    • Bicelles or nanodiscs as alternative membrane mimetics

    • Cholesterol hemisuccinate as a stabilizing additive

  • Protein engineering approaches:

    • Introduction of stabilizing mutations based on computational prediction

    • Disulfide engineering to lock conformational states

    • Thermostabilizing mutations identified through directed evolution

    • T4 lysozyme or other domain insertions for crystallization studies

  • Handling recommendations:

    • Avoid freeze-thaw cycles by storing in small aliquots

    • Maintain constant temperature during purification

    • Minimize exposure to air given E. minutum's anaerobic nature

    • Use oxygen-scavenging systems in buffers when appropriate

  • Stability assessment methods:

    • Differential scanning fluorimetry to monitor thermal stability

    • Size exclusion chromatography to track aggregation over time

    • Limited proteolysis to identify stable domains

    • Activity assays to correlate stability with function

These strategies should be empirically tested for E. minutum SecF, as optimal conditions are often protein-specific and require iterative optimization.

How can the specific interaction between E. minutum SecF and general chaperones (DnaJ/DnaK) be studied in the absence of SecB?

Investigating the unique interactions between E. minutum SecF and general chaperones that compensate for SecB absence requires specialized approaches:

  • In vitro binding assays:

    • Surface plasmon resonance (SPR) to measure binding kinetics between purified SecF and chaperones

    • Microscale thermophoresis to detect interactions in solution

    • Isothermal titration calorimetry for thermodynamic characterization

    • Pull-down assays using tagged components to confirm direct binding

  • Crosslinking approaches:

    • Chemical crosslinking coupled with mass spectrometry to map interaction interfaces

    • Photo-activatable crosslinkers for capturing transient interactions

    • In vivo crosslinking to capture physiologically relevant complexes

    • Zero-length crosslinkers to identify direct contact points

  • Functional characterization:

    • Reconstitution of translocation systems with and without DnaJ/DnaK

    • ATPase activity assays to measure the effect of chaperone binding on SecA function

    • Translocation efficiency measurement with model substrates

    • Comparison with systems containing canonical SecB

  • Structural biology approaches:

    • Cryo-electron microscopy of SecF-chaperone complexes

    • X-ray crystallography of co-crystallized components

    • Hydrogen-deuterium exchange mass spectrometry to map binding interfaces

    • NMR studies of labeled domains to detect conformational changes upon binding

  • Computational approaches:

    • Molecular dynamics simulations of SecF-chaperone interactions

    • Docking studies to predict binding interfaces

    • Sequence analysis to identify potential binding motifs not present in SecB-containing systems

These methodologies provide complementary information about this specialized chaperone interaction system that has evolved in E. minutum to function without SecB.

What considerations are important when designing assays to measure the translocation activity of reconstituted E. minutum SecF?

Designing translocation assays for E. minutum SecF requires careful consideration of multiple factors:

  • Selection of appropriate substrates:

    • Use model precursor proteins with signal sequences from E. minutum

    • Consider synthesizing radiolabeled or fluorescently tagged substrates

    • Design substrates of varying complexity to test translocation efficiency

    • Include controls with mutated signal sequences

  • Reconstitution system design:

    • Proteoliposomes containing purified SecYEG complex and SecF

    • Co-reconstitution with SecD and other accessory components

    • Incorporation of purified DnaK/DnaJ as SecB alternatives

    • Establishment of appropriate membrane potential

  • Energy source considerations:

    • ATP regeneration systems (creatine phosphate/creatine kinase)

    • Proton motive force generation (pH gradient, potassium diffusion potential)

    • Control experiments with non-hydrolyzable ATP analogs

  • Detection methods:

    • Protease protection assays to confirm successful translocation

    • Fluorescence-based real-time monitoring systems

    • Antibody detection of translocated proteins

    • Mass spectrometry to identify successfully translocated species

  • Controls and validation:

    • Comparison with well-characterized Sec systems from model organisms

    • SecF deletion/mutation variants to confirm specific contributions

    • Temperature and pH ranges to optimize activity

    • Inhibitor studies to confirm pathway specificity

Assay ComponentConsiderationRecommendation
Membrane systemLipid compositionTest phosphatidylethanolamine and phosphatidylglycerol mixtures
Energy sourceATP concentration1-5 mM with regeneration system
SubstrateSignal sequenceUse native E. minutum exported proteins
DetectionSensitivity vs. throughputRadiolabeling for quantitative studies, fluorescence for screening
Buffer conditionspH and saltMatch physiological conditions of gut environment

These assays should be designed to specifically address the unique features of E. minutum's secretion system, particularly its adaptation to function without SecB through the use of alternative chaperones.

How might comparative studies between E. minutum SecF and SecF from other bacterial phyla inform our understanding of protein secretion evolution?

Comparative analyses between E. minutum SecF and homologs from diverse bacterial lineages offer valuable evolutionary insights:

  • Phylogenetic context and significance:

    • E. minutum represents the phylum Elusimicrobia (formerly TG1), a relatively deep-branching bacterial lineage

    • Comparative analysis of 22 concatenated single-copy marker genes has corroborated the status of Elusimicrobia as a separate phylum

    • Comparing SecF across this evolutionary distance can reveal core conserved features versus lineage-specific adaptations

  • Methodological approaches:

    • Sequence-based phylogenetic analysis of SecF across bacterial phyla

    • Structural modeling to identify conserved domains and variable regions

    • Functional complementation studies in heterologous hosts

    • Domain-swapping experiments to determine functional equivalence

  • Key research questions to address:

    • How has SecF adapted to the absence of SecB in E. minutum?

    • Are there specific SecF adaptations related to the anaerobic lifestyle?

    • How do SecF-SecD interactions vary across phylogenetic distance?

    • What domains show the strongest conservation, suggesting essential functions?

  • Implications for understanding protein secretion:

    • Identification of minimal essential features required for SecF function

    • Discovery of alternative mechanisms for protein translocation

    • Insights into co-evolution of secretion components

    • Potential applications in biotechnology and heterologous protein expression

This comparative approach would provide a broader evolutionary context for understanding protein secretion mechanisms and their adaptability across diverse bacterial lineages.

What potential biotechnological applications might emerge from studying E. minutum SecF?

Research on E. minutum SecF may yield several biotechnological applications:

  • Enhanced heterologous protein secretion systems:

    • Development of SecF variants optimized for specific industrial protein expression

    • Creation of chimeric secretion systems incorporating beneficial features from E. minutum

    • Engineering of secretion pathways that function efficiently under anaerobic conditions

    • Design of systems with reduced dependence on SecB through lessons from E. minutum

  • Novel expression strategies for difficult-to-express proteins:

    • Utilization of E. minutum SecF in expression hosts for toxic or membrane proteins

    • Development of specialized secretion vectors incorporating E. minutum components

    • Creation of strains with engineered chaperone networks based on E. minutum's DnaK/DnaJ utilization

    • Optimization for industrial enzymes that require anaerobic production

  • Antimicrobial development opportunities:

    • Identification of inhibitors specifically targeting unique features of bacterial SecF

    • Development of compounds that disrupt SecF-DnaK/DnaJ interactions as novel antibiotics

    • Creation of screening platforms for secretion inhibitors using E. minutum components

    • Design of narrow-spectrum antimicrobials targeting specific bacterial lineages

  • Protein engineering applications:

    • Identification of signal sequences optimized for SecB-independent secretion

    • Development of protein tags that enhance SecF-mediated translocation

    • Creation of reporter systems for monitoring secretion efficiency

    • Engineering of membrane proteins with improved expression characteristics

These applications represent the translational potential of basic research on this unique component of E. minutum's secretion machinery.

How can advanced imaging techniques be applied to study the dynamics of E. minutum SecF in membrane environments?

Advanced imaging techniques offer powerful approaches to study SecF dynamics:

  • Single-molecule fluorescence techniques:

    • Single-molecule FRET to detect conformational changes during translocation

    • Fluorescence correlation spectroscopy to measure diffusion and oligomeric state

    • Single-particle tracking to follow SecF movement in reconstituted membranes

    • Super-resolution microscopy to visualize SecF distribution at nanoscale resolution

  • Cryo-electron microscopy approaches:

    • Single-particle cryo-EM of purified SecF or the entire translocon

    • Cryo-electron tomography of membrane-reconstituted systems

    • Time-resolved cryo-EM to capture different states of the translocation process

    • Subtomogram averaging to improve resolution of membrane-embedded complexes

  • Atomic force microscopy methods:

    • High-speed AFM to observe conformational dynamics in real-time

    • Force spectroscopy to measure interaction strengths between components

    • Topographical imaging of SecF in native-like membranes

    • Combined AFM-fluorescence microscopy for correlative studies

  • Emerging integrative techniques:

    • Correlative light and electron microscopy (CLEM) to combine dynamic and structural data

    • Mass photometry to determine precise oligomeric states in solution

    • Microfluidic approaches for real-time manipulation of reconstituted systems

    • In situ structural techniques such as cellular cryo-electron tomography

These imaging approaches can reveal the dynamic behavior of SecF during protein translocation, providing insights beyond static structural information.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.