Recombinant Elusimicrobium minutum UPF0059 membrane protein Emin_1326 (Emin_1326)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression and Purification

The protein is produced in Escherichia coli with an N-terminal His tag for affinity purification . Key production details include:

ParameterSpecification
Host SystemE. coli
Tag ConfigurationN-terminal His tag; optional C-terminal tags depending on vendor
FormLyophilized powder or liquid
Reconstitution0.1–1.0 mg/mL in sterile water; glycerol (5–50%) for long-term stability

Purification involves immobilized metal-affinity chromatography (IMAC), yielding >90% homogeneity . Stability is maintained at -20°C/-80°C, with avoidance of repeated freeze-thaw cycles .

Research Applications

Emin_1326 has been utilized in:

  • Membrane Protein Studies: Validation of computational tools like ProtRAP-LM for transmembrane helix prediction .

  • Metal Homeostasis: Mechanistic investigations into bacterial Mn²⁺ efflux systems .

  • Structural Biology: Crystallography and topology mapping due to its compact size and stability .

Recent advancements in deep learning (e.g., AlphaFold2) have improved predictions of its β-sheet-rich regions and membrane-anchored domains .

Comparative Genomic Insights

E. minutum’s genome (1.64 Mbp) encodes 60 PilE genes and pathways for sugar fermentation, but Emin_1326 stands out for its role in mitigating manganese toxicity—a trait shared with pathogenic bacteria . This makes it a model for studying metal resistance in uncultured microbial lineages.

Future Directions

Further studies could explore:

  • Mechanistic Details: Electrophysiological assays to characterize Mn²⁺ transport kinetics.

  • Biotechnological Uses: Engineering high-affinity variants for bioremediation or biosensing.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in sterile deionized water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, and customers can use this as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP; Emin_1326; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Elusimicrobium minutum (strain Pei191)
Target Names
mntP
Target Protein Sequence
MDIFTLLMIAAGLSMDNFAVSLASGCNPNIKIKDISKAALLFVAAHLVMFSLGWFGVSVI AERFDAYDHWISFGLLVFIGLRMIKEAAAKKGQQECVNITETFSRLLLIALATSMDALAV GISLSLAGVHFVLSVAAISFFVLITTFFGFKIGGKLGDKLGIKAEIFGGIVLIGIALKIL LDAMM
Uniprot No.

Target Background

Function
Emin_1326 likely functions as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Elusimicrobium minutum and why is it significant for research?

Elusimicrobium minutum (strain Pei191T) is the first cultured representative of the termite group 1 (TG1) phylum, now known as Elusimicrobia. This strictly anaerobic bacterium was isolated from the gut of a humivorous scarab beetle larva (Pachnoda ephippiata) . Its significance lies in its unique phylogenetic position and its representation of a previously uncultivated bacterial lineage commonly found in termite hindguts but also present in various other habitats . Studying E. minutum has provided insights into the biology of members of this phylum and expanded our understanding of bacterial diversity.

What is known about the UPF0059 membrane protein Emin_1326?

The Emin_1326 protein belongs to the UPF0059 family of uncharacterized membrane proteins identified in the complete genome sequence (1.64 Mbp) of E. minutum . As a membrane protein, it is likely part of the gram-negative cell envelope structure of E. minutum, which consists of two membranes with a thickness of 6 nm each and a periplasmic space measuring 6-8 nm . While specific functions of this protein remain largely uncharacterized, its conservation across species suggests important structural or functional roles in the cell membrane.

What cellular localization techniques are effective for studying Emin_1326?

For accurate cellular localization of Emin_1326, transmission electron microscopy (TEM) combined with immunogold labeling is highly effective. Based on established protocols for E. minutum, cells should be fixed with 3% (wt/vol) glutaraldehyde directly in the growth medium for 1 hour, followed by gentle centrifugation and washing in phosphate buffer . Secondary fixation with 2% (wt/vol) osmium tetroxide should be performed before dehydration and embedding in Epon 812 resin using standard procedures. For immunogold labeling, primary antibodies against the recombinant Emin_1326 protein can be used, followed by gold-conjugated secondary antibodies, before examination with a transmission electron microscope.

What growth conditions are optimal for expressing native Emin_1326 in E. minutum?

E. minutum is a strictly anaerobic bacterium, so optimal expression of native Emin_1326 requires anaerobic cultivation conditions. Based on physiological data complemented by genomic analysis, E. minutum utilizes sugars via the Embden-Meyerhof pathway . Therefore, a glucose-based medium under strict anaerobic conditions (typically using a CO2 or N2 atmosphere) would be suitable. Temperature and pH should be controlled to match the organism's optimal growth conditions. Since E. minutum possesses pathways for peptide degradation and amino acid utilization, supplementing the medium with certain amino acids may enhance growth and potentially affect membrane protein expression patterns.

How should researchers design experiments to study the function of recombinant Emin_1326?

To systematically study the function of recombinant Emin_1326, follow these experimental design steps:

  • Define your variables clearly:

    • Independent variable: Expression levels or mutations of Emin_1326

    • Dependent variables: Membrane integrity, cell morphology, metabolic activity

    • Control variables: Growth conditions, cell density, age of culture

  • Formulate testable hypotheses based on bioinformatic predictions of Emin_1326 function

  • Design experimental treatments:

    • Knockout/knockdown studies

    • Site-directed mutagenesis of conserved domains

    • Overexpression studies

    • Complementation assays

  • Assign appropriate control groups and biological replicates

  • Select sensitive measurement techniques for phenotypic changes

Control for extraneous variables by maintaining consistent laboratory conditions and using multiple methods to verify results .

What expression systems are most effective for producing recombinant Emin_1326?

The choice of expression system for recombinant Emin_1326 depends on research objectives and downstream applications. The following table compares effective expression systems:

Expression SystemAdvantagesDisadvantagesYieldRecommended Application
E. coli BL21(DE3)High yield, easy manipulation, cost-effectivePotential improper folding of membrane proteins, inclusion body formationHigh (5-10 mg/L)Initial functional studies, antibody production
E. coli C41/C43Specialized for membrane proteins, reduces toxicityLower yield than standard BL21Moderate (2-5 mg/L)Structural studies requiring properly folded protein
Insect cell linesBetter post-translational modifications, proper foldingMore complex, expensive, slower growthModerate (1-4 mg/L)Functional assays requiring native-like folding
Cell-free systemsAvoids toxicity issues, rapid expressionExpensive, potential scaling issuesLow to moderate (0.5-2 mg/L)Rapid screening of constructs and variants

For all systems, optimizing codon usage for the host and including appropriate signal sequences or fusion tags is essential for efficient expression and purification.

What purification strategy is recommended for isolating recombinant Emin_1326?

A multi-step purification strategy is recommended for isolating recombinant Emin_1326:

  • Membrane Fraction Isolation: Harvest cells and disrupt by sonication or French press in a suitable buffer (typically 50 mM Tris-HCl pH 7.5, 150 mM NaCl, with protease inhibitors). Separate membrane fractions by ultracentrifugation (100,000 × g for 1 hour).

  • Detergent Solubilization: Solubilize membrane proteins using a gentle detergent screen (n-dodecyl-β-D-maltoside, digitonin, or CHAPS) at concentrations just above their critical micelle concentration.

  • Affinity Chromatography: If the recombinant protein contains an affinity tag (e.g., His-tag, GST), use the appropriate affinity resin. For His-tagged constructs, include 20 mM imidazole in binding buffers to reduce non-specific binding.

  • Size Exclusion Chromatography: Further purify using gel filtration to separate monomeric protein from aggregates and remove remaining contaminants.

  • Quality Assessment: Verify purity by SDS-PAGE and Western blotting, and assess protein folding by circular dichroism spectroscopy.

Maintain detergent concentrations above CMC throughout all purification steps to prevent protein aggregation, and consider adding lipids post-purification to stabilize the protein structure.

How can researchers determine the membrane topology of Emin_1326?

Determining the membrane topology of Emin_1326 requires a combination of computational prediction and experimental validation approaches:

  • Computational Prediction:

    • Hydropathy analysis using algorithms like TMHMM, Phobius, or TOPCONS to predict transmembrane segments

    • Signal peptide prediction using SignalP

    • Identification of charged residue distribution to predict inside/outside orientation

  • Experimental Validation:

    • Cysteine scanning mutagenesis with thiol-reactive reagents

    • Protease protection assays with purified membrane vesicles

    • Fluorescence reporter fusions at predicted loops and termini

    • Epitope insertion followed by immunolabeling under permeabilizing and non-permeabilizing conditions

Combining these approaches provides a comprehensive topology map that can guide further structure-function studies of Emin_1326.

What techniques are available for studying protein-protein interactions involving Emin_1326?

Several complementary techniques can be employed to identify and characterize protein-protein interactions involving Emin_1326:

TechniquePrincipleAdvantagesLimitations
Pull-down assaysAffinity purification followed by mass spectrometryIdentifies multiple interaction partners simultaneouslyMay detect non-physiological interactions
Bacterial two-hybridProtein interaction reconstitutes a transcription factorWorks in bacterial systems, good for screeningMay miss transient interactions
FRET/BRETEnergy transfer between fluorescent tagsCan detect interactions in living cellsRequires careful controls and optimization
Surface plasmon resonanceDetection of binding kinetics on immobilized proteinProvides quantitative binding parametersRequires purified proteins
Cross-linking mass spectrometryChemical cross-linking followed by MS identificationCaptures transient interactions and provides structural informationComplex data analysis

When studying membrane proteins like Emin_1326, it's crucial to maintain proper detergent conditions during extraction and analysis to preserve native interactions. Validation of potential interaction partners should be performed using multiple independent techniques.

How can researchers investigate the potential role of Emin_1326 in the T2SS secretion pathway of E. minutum?

E. minutum possesses numerous genes encoding components of a type II secretion system (T2SS), although some essential components appear to be missing in the annotation . To investigate whether Emin_1326 plays a role in this secretion pathway:

  • Co-localization Studies: Determine if Emin_1326 co-localizes with known T2SS components using fluorescent protein fusions or immunofluorescence microscopy.

  • Interaction Mapping: Use pull-down assays or bacterial two-hybrid systems to test interactions between Emin_1326 and identified T2SS components, particularly focusing on the numerous pilE-like genes (60 in total) found in the E. minutum genome .

  • Gene Knockout/Knockdown: Generate Emin_1326 deletion or depletion strains and assess the impact on secretion efficiency of known T2SS substrates.

  • Secretome Analysis: Compare the extracellular protein profiles of wild-type and Emin_1326 mutant strains using quantitative proteomics.

  • Complementation Studies: Test whether Emin_1326 homologs from other bacteria can restore function in an E. minutum Emin_1326 mutant.

Since 40% of proteins encoded in the E. minutum genome contain signal peptides indicating export from the cell , examining whether disruption of Emin_1326 affects the secretion of this large group of proteins would be particularly informative.

What are the major challenges in expressing and purifying Emin_1326, and how can they be addressed?

Membrane proteins like Emin_1326 present several technical challenges during expression and purification:

  • Toxicity to Host Cells:

    • Challenge: Overexpression may disrupt host cell membranes

    • Solution: Use tightly regulated expression systems (e.g., pBAD, Tet-inducible) and lower induction temperatures (16-20°C)

  • Protein Misfolding and Aggregation:

    • Challenge: Improper folding leading to inclusion bodies

    • Solution: Test various detergents for solubilization; co-express with chaperones; use fusion partners like MBP that enhance solubility

  • Low Yield:

    • Challenge: Poor expression levels common for membrane proteins

    • Solution: Screen multiple expression hosts; optimize codon usage; test different signal sequences or fusion tags

  • Protein Instability:

    • Challenge: Rapid degradation during purification

    • Solution: Include protease inhibitors; maintain detergent above CMC; add stabilizing lipids; perform purification at 4°C

  • Functional Assessment:

    • Challenge: Difficulty in confirming proper folding and function

    • Solution: Develop activity assays or binding assays specific to predicted function; use circular dichroism to assess secondary structure

For E. minutum proteins specifically, consider the anaerobic nature of the source organism and potential oxygen sensitivity of the protein during purification steps.

How can researchers address data inconsistencies in Emin_1326 structural predictions?

When faced with inconsistent structural predictions for Emin_1326:

  • Evaluate Prediction Algorithm Assumptions:

    • Different algorithms use different training datasets and parameters

    • Use meta-servers that combine multiple prediction methods (e.g., PSIPRED, JPred)

    • Assign confidence scores to predictions and focus on high-confidence regions

  • Cross-validate with Experimental Data:

    • Use limited proteolysis to identify domain boundaries and structured regions

    • Perform cysteine accessibility studies to validate exposed regions

    • Use CD spectroscopy to determine secondary structure content

  • Homology Considerations:

    • Identify reliable structural homologs through sensitive sequence comparison (HHpred, FFAS)

    • Align predictions with experimental structures of homologous proteins

    • Consider evolutionary conservation patterns in the UPF0059 family

  • Integration Approach:

    • Create a consensus model incorporating multiple lines of evidence

    • Test model predictions experimentally

    • Iteratively refine the model with new experimental data

The table below summarizes common prediction discrepancies and resolution approaches:

Prediction DiscrepancyPossible CauseResolution Approach
Transmembrane helix countAlgorithm thresholds, hydrophobic regionsUse consensus from multiple predictors, validate with cysteine scanning
N-terminal signal peptide vs. transmembrane helixSimilar hydrophobicity patternsSignalP 5.0 specifically distinguishes between these elements
Secondary structure in loop regionsConformational flexibilityFocus on high-confidence predictions, validate with CD spectroscopy
Contradictory topology modelsLack of strong charge biasExperimental validation with reporter fusions or epitope mapping

What emerging techniques could advance understanding of Emin_1326 function?

Several cutting-edge methodologies show promise for elucidating Emin_1326 function:

  • Cryo-Electron Microscopy: The rapid advances in single-particle cryo-EM now allow membrane protein structures to be determined at near-atomic resolution without crystallization, which could reveal the detailed structure of Emin_1326 in native-like lipid environments.

  • AlphaFold2 and Structure Prediction: The revolutionary deep learning approaches to protein structure prediction could provide highly accurate structural models of Emin_1326, especially when combined with sparse experimental constraints.

  • Single-Molecule Tracking: Super-resolution microscopy techniques allow tracking of individual protein molecules in living cells, which could reveal dynamic aspects of Emin_1326 localization and movement within the membrane.

  • Native Mass Spectrometry: Advances in preserving non-covalent interactions during mass spectrometry analysis could identify stable complexes involving Emin_1326 and determine their stoichiometry.

  • CRISPR-Cas9 Genome Editing: Development of genetic tools for E. minutum would allow precise genomic modifications to study Emin_1326 function in its native context.

  • Synthetic Biology Approaches: Reconstitution of Emin_1326 and potential interaction partners in synthetic membrane systems could reveal emergent functional properties.

How might understanding Emin_1326 contribute to broader knowledge about bacterial membrane biology?

Research on Emin_1326 has potential to impact several areas of bacterial membrane biology:

  • Evolutionary Insights: As a member of the deep-branching Elusimicrobia phylum, understanding Emin_1326 could reveal ancient and conserved features of bacterial membrane organization. Comparative analysis with UPF0059 family members from diverse bacterial phyla could illuminate evolutionary trajectories of membrane systems.

  • Novel Secretion Mechanisms: The unusual combination of secretion system components in E. minutum (with missing GspL and GspM components yet maintaining functionality) suggests potentially novel mechanisms of protein transport across membranes, in which Emin_1326 might participate.

  • Adaptation to Anaerobic Environments: If Emin_1326 plays a role in membrane integrity or transport under anaerobic conditions, its study could reveal specializations for life in oxygen-depleted niches like insect guts.

  • Protein Family Annotation: Characterizing the function of Emin_1326 would help annotate the entire UPF0059 family of uncharacterized proteins, potentially revealing new functional classes of membrane proteins across bacteria.

  • Host-Microbe Interactions: Given that E. minutum was isolated from an insect gut, understanding its membrane proteins could provide insights into how bacteria adapt to host environments and potentially contribute to symbiotic relationships.

What are the critical considerations when publishing research on Emin_1326?

When preparing to publish research on Emin_1326, researchers should consider:

  • Nomenclature Clarity: Given the relatively recent classification of Elusimicrobia as a separate phylum , ensure consistent and clear nomenclature throughout the manuscript. Avoid creating new abbreviations for Emin_1326 and maintain the established UPF0059 family designation.

  • Method Validation: For novel techniques applied to this understudied protein, include comprehensive validation data and appropriate controls. This is particularly important for membrane protein purification protocols and functional assays.

  • Comparative Analysis: Place findings in the broader context of the UPF0059 protein family and membrane biology by including comparative analyses with homologs from better-characterized organisms.

  • Structural Data Deposition: Deposit structural data in appropriate databases (PDB, EMDB) with thorough annotation to support future research efforts.

  • Sequence-Function Relationships: Clearly articulate the relationship between sequence features and functional observations, supporting any functional assignments with multiple lines of evidence.

  • Phylogenetic Context: Include phylogenetic analyses that position E. minutum and Emin_1326 within their respective evolutionary contexts, contributing to our understanding of this deep-branching bacterial lineage.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.