Recombinant Full Length Emericella nidulans 3-ketodihydrosphingosine reductase Tsc10(Tsc10) Protein is a protein that was expressed in E. coli . It is fused to an N-terminal His tag and is full length, comprising amino acids 1-369 of the protein .
| Category | Description |
|---|---|
| Species | Emericella nidulans |
| Source | E. coli |
| Tag | His |
| Protein Length | Full Length (1-369aa) |
| Form | Lyophilized powder |
| AA Sequence | MHPSLPSIIYDASPTALGISAVFGALFFYTLVKMFGFLARENQFVVEGRTVVITGGSEGMGKAVACQLAQKGANIVIVARTLQKLEEAIEAIKGSAANVNKQRFHYISADLTKPEECERIMTEVTEWNDGMPPDIVWCCAGYCTPGYFVETSVQTLKDQMDTVYWTAANTAHAILRKWLV PINPSHQRPLPRRHLIFTCSTLAFVPIAGYAPYSPAKAAMRALSDTLCQEIEVYNGSRASKERARATPADVKIHTVFPMGILSPGFDNEQQIKPALTKQLESADKPQTPKEVARIAIEAI ERGEYLITTMFVGDVMKGAALGPSPRNSWFRDTCTGWLSNLLFLGVVPDLRKQAFNWGAKNGVPTSPSA |
| Purity | Greater than 90% as determined by SDS-PAGE |
| Gene Name | tsc10 |
| Synonyms | tsc10; AN1165; 3-ketodihydrosphingosine reductase tsc10; 3-dehydrosphinganine reductase; KDS reductase |
| UniProt ID | Q5BE65 |
Emericella nidulans (also known as Aspergillus nidulans) is a filamentous fungus that has a wide range of applications in genetics, molecular biology, and secondary metabolite research . It is known for its ability to produce various secondary metabolites, including emericellamides and asperfuranone, which possess antibiotic and other biological activities .
Tsc10, or 3-ketodihydrosphingosine reductase, is an enzyme involved in sphingolipid biosynthesis . Specifically, it catalyzes the reduction of 3-ketodihydrosphingosine to dihydrosphingosine, a crucial step in the sphingolipid pathway. Sphingolipids are important components of cell membranes and play roles in various cellular processes, such as cell signaling, apoptosis, and stress response .
The recombinant form of Emericella nidulans Tsc10 is produced in E. coli using genetic engineering techniques . The encoding gene is cloned and expressed in E. coli, resulting in the production of the protein with a His tag for purification purposes . Recombinant proteins like this are valuable for biochemical assays, structural studies, and drug discovery efforts .
Aspergillus nidulans produces emericellamide A, an antibiotic compound with mixed origins from polyketide and amino acid building blocks . Gene targeting techniques have identified the genes involved in emericellamide biosynthesis, which include a polyketide synthase (PKS) and a nonribosomal peptide synthetase (NRPS) .
Aspergillus nidulans has a genome that can potentially produce a large range of natural products . Many of these products are unknown . The fungus produces the antibiotic emericellamide A, and also four related compounds, emericellamides C-F . The structures of these compounds were solved through NMR analyses and comparison to emericellamide A .
The genome of A. nidulans harbors numerous secondary metabolite gene clusters that are silent under standard conditions . Activation of these silent gene clusters can lead to the production of novel compounds, such as asperfuranone, by manipulating regulatory genes like scpR .
KEGG: ani:AN1165.2
STRING: 162425.CADANIAP00001461
3-ketodihydrosphingosine reductase (TSC10) catalyzes the second step in de novo sphingolipid biosynthesis, specifically the reduction of 3-ketodihydrosphingosine to produce dihydrosphingosine (sphinganine). This enzyme belongs to the short-chain dehydrogenase/reductase (SDR) superfamily and represents a critical point in the sphingolipid biosynthetic pathway. Sphingolipids are essential membrane components in fungi and play significant roles in cellular signaling, membrane integrity, and stress responses. The enzyme utilizes NADPH as a cofactor in the reduction reaction, functioning through a conserved catalytic triad mechanism typical of the SDR family.
Experimental approaches to study TSC10 function typically involve enzyme activity assays measuring the conversion of substrate to product using methods such as HPLC or mass spectrometry. When designing such experiments, researchers should account for the enzyme's preference for NADPH as a cofactor and ensure appropriate substrate preparation and reaction conditions.
Emericella nidulans and Aspergillus nidulans refer to the same organism at different stages of its life cycle. The name Emericella nidulans represents the teleomorphic (sexual) state, while Aspergillus nidulans refers to the anamorphic (asexual) state. In scientific literature, both names are used interchangeably, though recent taxonomic conventions have favored Aspergillus nidulans as the preferred nomenclature. The organism is a model filamentous fungus widely used in molecular biology and genetics research.
When searching literature for information on TSC10 from this organism, researchers should use both names to ensure comprehensive results. Both terms should be included in keywords when publishing new findings related to this enzyme to improve discoverability of research.
The crystal structure of TSC10 from Cryptococcus neoformans (though not specifically from E. nidulans) reveals a Rossmann fold with a central seven-stranded β-sheet flanked by α-helices on both sides, which is characteristic of the SDR superfamily. Several key structural features contribute to function:
A conserved catalytic triad (typically Ser-Tyr-Lys) forms the active site
NADPH binding occurs in a specific pocket formed by the Rossmann fold
A flexible "substrate loop" accommodates the lipid substrate
The C-terminal region often participates in oligomerization
Research has revealed that TSC10 predominantly forms dimers in solution, with a minor population forming tetramers. The dimer interface involves both hydrophobic and hydrophilic interactions mediated by helices α4 and α5, and the loop connecting strand β4 and helix α4.
This structural information can guide site-directed mutagenesis experiments to probe structure-function relationships and inform inhibitor design strategies that could selectively target fungal enzymes while sparing mammalian homologs.
While heterologous expression of TSC10 has been reported in several systems, each presents unique advantages and challenges. The following table summarizes common expression systems:
| Expression System | Advantages | Challenges | Yield Considerations |
|---|---|---|---|
| E. coli | Rapid growth, simple media requirements, well-established protocols | Lack of post-translational modifications, protein folding issues, inclusion body formation | Often requires optimization of codon usage, fusion tags, and solubility enhancers |
| S. cerevisiae | Eukaryotic system with protein folding machinery, post-translational modifications | Lower yields than E. coli, longer culture times | Functions better for fungal proteins due to similar cellular environment |
| Aspergillus/Emericella | Native environment, proper folding and modifications | Complex genetics, longer development time | Can achieve high secretion levels with appropriate signal sequences |
| Mammalian cells | Most sophisticated folding and modification machinery | Expensive, complex, low yields | Typically not necessary for fungal enzymes |
Historical approaches using E. coli and S. cerevisiae as hosts for expression of similar enzymes have resulted in intracellular accumulation rather than efficient secretion. For optimal expression of TSC10, researchers should consider codon optimization for the selected host and inclusion of appropriate tags for detection and purification while ensuring these modifications don't interfere with enzyme activity.
Transcriptome analysis offers a powerful approach for identifying bottlenecks and optimizing recombinant protein expression in E. nidulans. When comparing gene expression profiles between a recombinant protein-producing strain and its wild-type parent in continuous culture using expressed sequence tag (EST) microarrays, researchers can identify specific changes in gene expression related to protein production and secretion.
Research demonstrates that overexpression of a secreted recombinant protein in E. nidulans triggers responses that more closely resemble the unfolded protein response (UPR) in vivo, rather than the more dramatic changes observed when using secretion blockers to mimic protein overproduction. Key upregulated genes during recombinant protein expression include ER chaperones like bipA and protein disulfide isomerase pdiA, which have been previously shown to be induced during recombinant protein secretion.
For researchers seeking to optimize TSC10 expression, a methodological approach would include:
Establishing continuous culture conditions for both recombinant and control strains
Sampling RNA at multiple time points during growth and protein production
Performing transcriptome analysis using microarrays or RNA-seq
Identifying differentially expressed genes related to protein folding, secretion, and stress response
Engineering strains with modified expression of these identified genes to enhance production
This approach allows for targeted genetic modifications rather than empirical optimization, potentially leading to more efficient TSC10 production strains.
Purification of recombinant TSC10 requires careful consideration of the enzyme's stability and cofactor requirements. A comprehensive purification strategy should include:
Initial capture step: Affinity chromatography using N-terminal or C-terminal tags (His6, GST, or MBP) taking care that tag placement doesn't interfere with dimerization interfaces identified in the crystal structure
Intermediate purification: Ion exchange chromatography based on the theoretical pI of TSC10
Polishing step: Size exclusion chromatography to separate dimeric and tetrameric forms
Throughout purification, all buffers should contain:
Appropriate pH (typically 7.0-8.0 for SDR enzymes)
Reducing agents (1-5 mM DTT or β-mercaptoethanol) to maintain cysteine residues
Glycerol (10-20%) for stability
Consider including low concentrations of NADPH to stabilize the active site
Activity assays should be performed after each purification step to track recovery and specific activity. The inclusion of protease inhibitors is essential during initial extraction steps but should be removed before activity assays to prevent interference.
The oligomeric state of TSC10 affects its activity, with research showing it predominantly exists as a dimer in solution with a minor tetrameric population. Purification conditions should be optimized to maintain the native oligomeric state that exhibits highest activity.
Designing selective inhibitors requires exploitation of structural differences between fungal TSC10 and mammalian KDSR (also known as FVT-1). Crystal structure analysis reveals that residues forming hydrogen bonds and salt bridges in the dimer interface of fungal TSC10 are not conserved between fungal and mammalian homologs, providing a potential avenue for selective targeting.
A methodological approach to inhibitor development would include:
Computational analysis:
Sequence alignment of fungal TSC10 and mammalian KDSR proteins
Homology modeling if structures aren't available for specific species
Identification of non-conserved regions, particularly at dimer interfaces
Virtual screening of compound libraries against these regions
Biochemical validation:
Expression and purification of both fungal TSC10 and mammalian KDSR
Development of parallel assay systems with identical detection methods
High-throughput screening with compound libraries
Determination of IC50 values and selectivity indices
Structure-activity relationship studies:
Co-crystallization with lead compounds
Iterative optimization based on structural insights
Testing against panels of fungal and mammalian enzymes
The significant flexibility observed in the catalytic site of fungal TSC10, including disordered regions like the "substrate loop" and partially ordered NADPH cofactor, suggests that induced-fit mechanisms may play a role in catalysis. This flexibility could be exploited in inhibitor design, potentially targeting conformational states unique to the fungal enzyme.
Low expression of recombinant proteins in E. nidulans can result from multiple factors. A systematic troubleshooting approach should include:
Transcriptional issues:
Verify promoter strength and induction conditions
Check for premature transcription termination
Consider codon optimization for E. nidulans
Examine mRNA stability using northern blot or RT-qPCR
Translational efficiency:
Optimize the Kozak consensus sequence
Ensure appropriate signal peptide for secretion
Consider fusion partners that enhance translation
Post-translational processing:
Secretion bottlenecks:
Analyze intracellular accumulation using fractionation
Co-express key secretion components identified in transcriptome analyses
Utilize strains with enhanced secretion capabilities
Research has shown that in E. nidulans, recombinant protein expression can trigger responses similar to the unfolded protein response. Monitoring markers of this response, such as the ER chaperone bipA and protein disulfide isomerase pdiA, can provide insights into whether protein folding is a limitation. Co-expression of these chaperones might enhance proper folding and secretion of recombinant TSC10.
Comprehensive characterization of TSC10 activity requires multiple analytical approaches to measure both substrate consumption and product formation. The most effective methods include:
Spectrophotometric assays:
Continuous monitoring of NADPH oxidation at 340 nm
High-throughput capability for kinetic studies
Limited by spectral interference from crude samples
Chromatographic methods:
HPLC separation of substrate and product
LC-MS for increased sensitivity and specificity
Can be coupled with radioisotope labeling for enhanced detection
Mass spectrometry:
For kinetic characterization, researchers should determine:
Km and Vmax for both 3-ketodihydrosphingosine and NADPH
Optimal pH and temperature
Effects of potential inhibitors
Substrate specificity using structural analogs
When examining the impact of mutations or comparing enzymes from different species, researchers should establish standardized activity assays that can detect subtle differences in catalytic efficiency. The stability of both substrate and product should be considered, as sphingolipid intermediates can be unstable under certain conditions.
Molecular docking provides valuable insights into enzyme-substrate and enzyme-inhibitor interactions that can guide experimental design. For TSC10, molecular docking has been successfully used to identify bioactive compounds that can inhibit related enzymes.
A methodological approach to molecular docking studies of TSC10 includes:
Preparation steps:
Crystal structure preparation (removing water, adding hydrogens)
Defining the binding site (typically where NADPH and substrate bind)
Preparation of small molecule libraries with appropriate 3D conformations
Validation using known substrates or inhibitors if available
Docking protocol:
Selection of appropriate algorithms (flexible vs. rigid docking)
Establishment of scoring functions that account for key interactions
Consideration of protein flexibility, particularly in the "substrate loop" region
Integration of NADPH cofactor in the binding site
Analysis of results:
Clustering of docking poses
Evaluation of binding energy scores
Analysis of specific interactions (hydrogen bonds, hydrophobic contacts)
Comparison with experimental data when available
For validation of docking studies, researchers should consider follow-up experimental approaches such as site-directed mutagenesis of predicted contact residues, binding assays using purified protein, and enzyme inhibition studies with top-scoring compounds.
The crystal structure of TSC10 from Cryptococcus neoformans provides a valuable template for homology modeling of E. nidulans TSC10 if the structure is not directly available. When using this approach, researchers should carefully validate the model using techniques such as Ramachandran plot analysis and comparison of conserved regions.
Enhancing stability and solubility of recombinant TSC10 is critical for obtaining sufficient quantities of active enzyme for biochemical and structural studies. Research-backed strategies include:
Fusion protein approaches:
N-terminal fusions: MBP (maltose-binding protein), GST (glutathione S-transferase)
C-terminal fusions: Consider impact on dimerization interfaces
Thioredoxin fusion to enhance disulfide bond formation
Inclusion of cleavable linkers for tag removal
Co-expression strategies:
Buffer optimization:
Screening buffering agents (HEPES, Tris, phosphate)
Addition of stabilizing agents (glycerol, trehalose)
Inclusion of reduced NADPH to stabilize enzyme structure
Detergents for solubilization if membrane-associated
Expression condition optimization:
Reduced temperature cultivation (20-25°C) to slow folding
Controlled induction to prevent overwhelming cellular machinery
Extended expression periods with continuous monitoring
Research on related enzymes from the SDR family suggests that maintaining the appropriate oligomeric state is crucial for activity. For TSC10, which predominantly forms dimers in solution with a minor tetrameric population, purification conditions should be optimized to preserve the native quaternary structure.
Researchers should systematically test these strategies using small-scale expression trials before scaling up, and include activity assays at each step to ensure the modified conditions preserve enzymatic function.
When faced with conflicting data from different expression systems, researchers should implement a systematic analytical approach:
Data categorization and comparison:
Create a comprehensive table comparing key parameters (yield, activity, stability) across systems
Identify patterns in which specific properties are consistently affected by expression system
Distinguish between differences in enzymatic properties versus expression efficiency
Biochemical characterization across systems:
Standardize purification protocols to minimize system-specific artifacts
Compare kinetic parameters (Km, Vmax, substrate specificity) using identical assay conditions
Analyze post-translational modifications that might differ between systems
Assess oligomeric state in each system using techniques like size exclusion chromatography
Structural validation:
Compare protein folding using circular dichroism or thermal shift assays
Consider limited proteolysis to identify structural differences
If possible, obtain crystal structures from proteins expressed in different systems
Biological relevance assessment:
Compare properties to those of the native enzyme if available
Evaluate which system provides enzyme characteristics most similar to in vivo observations
Consider the intended application (structural studies, inhibitor screening, etc.)
Historical challenges with expression of related enzymes in E. coli and S. cerevisiae have included intracellular accumulation rather than efficient secretion. When comparing data from prokaryotic versus eukaryotic expression systems, researchers should consider fundamental differences in protein folding machinery and post-translational modifications.
Kinetic parameter determination:
Nonlinear regression for Michaelis-Menten kinetics
Lineweaver-Burk, Eadie-Hofstee, or Hanes-Woolf plots for visualization
Bootstrap resampling for confidence interval estimation
Global fitting for complex kinetic models
Comparative analysis:
ANOVA for comparing multiple conditions or mutants
Student's t-test (paired or unpaired) for binary comparisons
Non-parametric tests (Mann-Whitney, Kruskal-Wallis) for non-normally distributed data
Multiple comparison corrections (Bonferroni, Tukey's HSD) when testing several hypotheses
Reproducibility assessment:
Calculation of intra-assay and inter-assay coefficients of variation
Power analysis to determine appropriate sample sizes
Meta-analysis techniques for combining data across studies
Advanced modeling:
Principal component analysis for multivariate data
Hierarchical clustering for identifying patterns in inhibitor studies
Machine learning approaches for complex structure-activity relationships
When reporting inhibition data for TSC10, researchers should clearly state the inhibition model used (competitive, noncompetitive, uncompetitive, or mixed) and provide appropriate statistical measures such as IC50 values with confidence intervals.
For publication, researchers should include detailed statistical methods, sample sizes, and raw data availability statements to ensure reproducibility. Graphical presentation should include error bars representing standard deviation or standard error as appropriate, with clear explanation in figure legends.
Systems biology offers powerful tools for understanding TSC10 within the broader context of sphingolipid metabolism and cellular function. Methodological approaches include:
Multi-omics integration:
Combining transcriptomics, proteomics, and metabolomics data
Temporal profiling during stress conditions that affect sphingolipid metabolism
Spatial analysis of TSC10 localization and interaction partners
Correlation of TSC10 expression with downstream metabolites
Flux analysis:
Isotope labeling to track sphingolipid precursors through biosynthetic pathways
Quantitative models of sphingolipid metabolism incorporating enzyme kinetics
Perturbation experiments with TSC10 inhibitors or genetic modifications
Computational simulation of metabolic networks
Network analysis:
Protein-protein interaction mapping using techniques like BioID or APEX
Genetic interaction screens (synthetic lethality, epistasis)
Regulatory network reconstruction identifying transcription factors controlling TSC10
Cross-species comparison of sphingolipid regulatory networks
Phenotypic profiling:
High-content screening with TSC10 mutations or inhibitors
Correlation of sphingolipid profiles with cellular phenotypes
Machine learning approaches to identify subtle phenotypic signatures
Transcriptome analysis of recombinant protein-expressing Aspergillus/Emericella strains has already revealed connections between protein production and cellular stress responses. Building on this foundation, researchers can explore how TSC10 activity influences and is influenced by these cellular networks.
Future research should focus on understanding not just the isolated enzyme but its place within dynamic cellular systems, potentially revealing new regulatory mechanisms and therapeutic opportunities.