Recombinant Emericella nidulans 3-ketodihydrosphingosine reductase tsc10 (tsc10)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Full Length Emericella nidulans 3-ketodihydrosphingosine reductase Tsc10(Tsc10) Protein is a protein that was expressed in E. coli . It is fused to an N-terminal His tag and is full length, comprising amino acids 1-369 of the protein .

Table 1: Protein Information

CategoryDescription
SpeciesEmericella nidulans
SourceE. coli
TagHis
Protein LengthFull Length (1-369aa)
FormLyophilized powder
AA SequenceMHPSLPSIIYDASPTALGISAVFGALFFYTLVKMFGFLARENQFVVEGRTVVITGGSEGMGKAVACQLAQKGANIVIVARTLQKLEEAIEAIKGSAANVNKQRFHYISADLTKPEECERIMTEVTEWNDGMPPDIVWCCAGYCTPGYFVETSVQTLKDQMDTVYWTAANTAHAILRKWLV PINPSHQRPLPRRHLIFTCSTLAFVPIAGYAPYSPAKAAMRALSDTLCQEIEVYNGSRASKERARATPADVKIHTVFPMGILSPGFDNEQQIKPALTKQLESADKPQTPKEVARIAIEAI ERGEYLITTMFVGDVMKGAALGPSPRNSWFRDTCTGWLSNLLFLGVVPDLRKQAFNWGAKNGVPTSPSA
PurityGreater than 90% as determined by SDS-PAGE
Gene Nametsc10
Synonymstsc10; AN1165; 3-ketodihydrosphingosine reductase tsc10; 3-dehydrosphinganine reductase; KDS reductase
UniProt IDQ5BE65

Biological Context

Emericella nidulans (also known as Aspergillus nidulans) is a filamentous fungus that has a wide range of applications in genetics, molecular biology, and secondary metabolite research . It is known for its ability to produce various secondary metabolites, including emericellamides and asperfuranone, which possess antibiotic and other biological activities .

Function and Significance of Tsc10

Tsc10, or 3-ketodihydrosphingosine reductase, is an enzyme involved in sphingolipid biosynthesis . Specifically, it catalyzes the reduction of 3-ketodihydrosphingosine to dihydrosphingosine, a crucial step in the sphingolipid pathway. Sphingolipids are important components of cell membranes and play roles in various cellular processes, such as cell signaling, apoptosis, and stress response .

Recombinant Production and Applications

The recombinant form of Emericella nidulans Tsc10 is produced in E. coli using genetic engineering techniques . The encoding gene is cloned and expressed in E. coli, resulting in the production of the protein with a His tag for purification purposes . Recombinant proteins like this are valuable for biochemical assays, structural studies, and drug discovery efforts .

Emericellamides

Aspergillus nidulans produces emericellamide A, an antibiotic compound with mixed origins from polyketide and amino acid building blocks . Gene targeting techniques have identified the genes involved in emericellamide biosynthesis, which include a polyketide synthase (PKS) and a nonribosomal peptide synthetase (NRPS) .

Biosynthetic Pathways and Secondary Metabolites

Aspergillus nidulans has a genome that can potentially produce a large range of natural products . Many of these products are unknown . The fungus produces the antibiotic emericellamide A, and also four related compounds, emericellamides C-F . The structures of these compounds were solved through NMR analyses and comparison to emericellamide A .

Silent Gene Clusters

The genome of A. nidulans harbors numerous secondary metabolite gene clusters that are silent under standard conditions . Activation of these silent gene clusters can lead to the production of novel compounds, such as asperfuranone, by manipulating regulatory genes like scpR .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
tsc10; AN1165; 3-ketodihydrosphingosine reductase tsc10; 3-dehydrosphinganine reductase; KDS reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-369
Protein Length
full length protein
Species
Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)
Target Names
tsc10
Target Protein Sequence
MHPSLPSIIYDASPTALGISAVFGALFFYTLVKMFGFLARENQFVVEGRTVVITGGSEGM GKAVACQLAQKGANIVIVARTLQKLEEAIEAIKGSAANVNKQRFHYISADLTKPEECERI MTEVTEWNDGMPPDIVWCCAGYCTPGYFVETSVQTLKDQMDTVYWTAANTAHAILRKWLV PINPSHQRPLPRRHLIFTCSTLAFVPIAGYAPYSPAKAAMRALSDTLCQEIEVYNGSRAS KERARATPADVKIHTVFPMGILSPGFDNEQQIKPALTKQLESADKPQTPKEVARIAIEAI ERGEYLITTMFVGDVMKGAALGPSPRNSWFRDTCTGWLSNLLFLGVVPDLRKQAFNWGAK NGVPTSPSA
Uniprot No.

Target Background

Function
Catalyzes the reduction of 3-ketodihydrosphingosine (KDS) to dihydrosphingosine (DHS).
Database Links
Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is the function of 3-ketodihydrosphingosine reductase (TSC10) in fungal metabolism?

3-ketodihydrosphingosine reductase (TSC10) catalyzes the second step in de novo sphingolipid biosynthesis, specifically the reduction of 3-ketodihydrosphingosine to produce dihydrosphingosine (sphinganine). This enzyme belongs to the short-chain dehydrogenase/reductase (SDR) superfamily and represents a critical point in the sphingolipid biosynthetic pathway. Sphingolipids are essential membrane components in fungi and play significant roles in cellular signaling, membrane integrity, and stress responses. The enzyme utilizes NADPH as a cofactor in the reduction reaction, functioning through a conserved catalytic triad mechanism typical of the SDR family.

Experimental approaches to study TSC10 function typically involve enzyme activity assays measuring the conversion of substrate to product using methods such as HPLC or mass spectrometry. When designing such experiments, researchers should account for the enzyme's preference for NADPH as a cofactor and ensure appropriate substrate preparation and reaction conditions.

What is the relationship between Emericella nidulans and Aspergillus nidulans in scientific literature?

Emericella nidulans and Aspergillus nidulans refer to the same organism at different stages of its life cycle. The name Emericella nidulans represents the teleomorphic (sexual) state, while Aspergillus nidulans refers to the anamorphic (asexual) state. In scientific literature, both names are used interchangeably, though recent taxonomic conventions have favored Aspergillus nidulans as the preferred nomenclature. The organism is a model filamentous fungus widely used in molecular biology and genetics research.

When searching literature for information on TSC10 from this organism, researchers should use both names to ensure comprehensive results. Both terms should be included in keywords when publishing new findings related to this enzyme to improve discoverability of research.

How does the structure of fungal TSC10 contribute to its catalytic function?

The crystal structure of TSC10 from Cryptococcus neoformans (though not specifically from E. nidulans) reveals a Rossmann fold with a central seven-stranded β-sheet flanked by α-helices on both sides, which is characteristic of the SDR superfamily. Several key structural features contribute to function:

  • A conserved catalytic triad (typically Ser-Tyr-Lys) forms the active site

  • NADPH binding occurs in a specific pocket formed by the Rossmann fold

  • A flexible "substrate loop" accommodates the lipid substrate

  • The C-terminal region often participates in oligomerization

Research has revealed that TSC10 predominantly forms dimers in solution, with a minor population forming tetramers. The dimer interface involves both hydrophobic and hydrophilic interactions mediated by helices α4 and α5, and the loop connecting strand β4 and helix α4.

This structural information can guide site-directed mutagenesis experiments to probe structure-function relationships and inform inhibitor design strategies that could selectively target fungal enzymes while sparing mammalian homologs.

What expression systems have been successfully used for recombinant production of fungal TSC10?

While heterologous expression of TSC10 has been reported in several systems, each presents unique advantages and challenges. The following table summarizes common expression systems:

Expression SystemAdvantagesChallengesYield Considerations
E. coliRapid growth, simple media requirements, well-established protocolsLack of post-translational modifications, protein folding issues, inclusion body formationOften requires optimization of codon usage, fusion tags, and solubility enhancers
S. cerevisiaeEukaryotic system with protein folding machinery, post-translational modificationsLower yields than E. coli, longer culture timesFunctions better for fungal proteins due to similar cellular environment
Aspergillus/EmericellaNative environment, proper folding and modificationsComplex genetics, longer development timeCan achieve high secretion levels with appropriate signal sequences
Mammalian cellsMost sophisticated folding and modification machineryExpensive, complex, low yieldsTypically not necessary for fungal enzymes

Historical approaches using E. coli and S. cerevisiae as hosts for expression of similar enzymes have resulted in intracellular accumulation rather than efficient secretion. For optimal expression of TSC10, researchers should consider codon optimization for the selected host and inclusion of appropriate tags for detection and purification while ensuring these modifications don't interfere with enzyme activity.

How can transcriptome analysis guide optimization of recombinant TSC10 expression in Emericella nidulans?

Transcriptome analysis offers a powerful approach for identifying bottlenecks and optimizing recombinant protein expression in E. nidulans. When comparing gene expression profiles between a recombinant protein-producing strain and its wild-type parent in continuous culture using expressed sequence tag (EST) microarrays, researchers can identify specific changes in gene expression related to protein production and secretion.

Research demonstrates that overexpression of a secreted recombinant protein in E. nidulans triggers responses that more closely resemble the unfolded protein response (UPR) in vivo, rather than the more dramatic changes observed when using secretion blockers to mimic protein overproduction. Key upregulated genes during recombinant protein expression include ER chaperones like bipA and protein disulfide isomerase pdiA, which have been previously shown to be induced during recombinant protein secretion.

For researchers seeking to optimize TSC10 expression, a methodological approach would include:

  • Establishing continuous culture conditions for both recombinant and control strains

  • Sampling RNA at multiple time points during growth and protein production

  • Performing transcriptome analysis using microarrays or RNA-seq

  • Identifying differentially expressed genes related to protein folding, secretion, and stress response

  • Engineering strains with modified expression of these identified genes to enhance production

This approach allows for targeted genetic modifications rather than empirical optimization, potentially leading to more efficient TSC10 production strains.

What purification strategies yield the highest activity retention for recombinant TSC10?

Purification of recombinant TSC10 requires careful consideration of the enzyme's stability and cofactor requirements. A comprehensive purification strategy should include:

  • Initial capture step: Affinity chromatography using N-terminal or C-terminal tags (His6, GST, or MBP) taking care that tag placement doesn't interfere with dimerization interfaces identified in the crystal structure

  • Intermediate purification: Ion exchange chromatography based on the theoretical pI of TSC10

  • Polishing step: Size exclusion chromatography to separate dimeric and tetrameric forms

Throughout purification, all buffers should contain:

  • Appropriate pH (typically 7.0-8.0 for SDR enzymes)

  • Reducing agents (1-5 mM DTT or β-mercaptoethanol) to maintain cysteine residues

  • Glycerol (10-20%) for stability

  • Consider including low concentrations of NADPH to stabilize the active site

Activity assays should be performed after each purification step to track recovery and specific activity. The inclusion of protease inhibitors is essential during initial extraction steps but should be removed before activity assays to prevent interference.

The oligomeric state of TSC10 affects its activity, with research showing it predominantly exists as a dimer in solution with a minor tetrameric population. Purification conditions should be optimized to maintain the native oligomeric state that exhibits highest activity.

What are the key considerations for designing inhibitor studies targeting fungal TSC10 while sparing mammalian homologs?

Designing selective inhibitors requires exploitation of structural differences between fungal TSC10 and mammalian KDSR (also known as FVT-1). Crystal structure analysis reveals that residues forming hydrogen bonds and salt bridges in the dimer interface of fungal TSC10 are not conserved between fungal and mammalian homologs, providing a potential avenue for selective targeting.

A methodological approach to inhibitor development would include:

  • Computational analysis:

    • Sequence alignment of fungal TSC10 and mammalian KDSR proteins

    • Homology modeling if structures aren't available for specific species

    • Identification of non-conserved regions, particularly at dimer interfaces

    • Virtual screening of compound libraries against these regions

  • Biochemical validation:

    • Expression and purification of both fungal TSC10 and mammalian KDSR

    • Development of parallel assay systems with identical detection methods

    • High-throughput screening with compound libraries

    • Determination of IC50 values and selectivity indices

  • Structure-activity relationship studies:

    • Co-crystallization with lead compounds

    • Iterative optimization based on structural insights

    • Testing against panels of fungal and mammalian enzymes

The significant flexibility observed in the catalytic site of fungal TSC10, including disordered regions like the "substrate loop" and partially ordered NADPH cofactor, suggests that induced-fit mechanisms may play a role in catalysis. This flexibility could be exploited in inhibitor design, potentially targeting conformational states unique to the fungal enzyme.

How can researchers troubleshoot low expression levels of recombinant TSC10 in Emericella nidulans?

Low expression of recombinant proteins in E. nidulans can result from multiple factors. A systematic troubleshooting approach should include:

  • Transcriptional issues:

    • Verify promoter strength and induction conditions

    • Check for premature transcription termination

    • Consider codon optimization for E. nidulans

    • Examine mRNA stability using northern blot or RT-qPCR

  • Translational efficiency:

    • Optimize the Kozak consensus sequence

    • Ensure appropriate signal peptide for secretion

    • Consider fusion partners that enhance translation

  • Post-translational processing:

    • Evaluate protein folding using chaperone co-expression

    • Monitor unfolded protein response markers (bipA, pdiA)

    • Consider lower growth temperatures to slow folding

    • Examine glycosylation if predicted sites exist

  • Secretion bottlenecks:

    • Analyze intracellular accumulation using fractionation

    • Co-express key secretion components identified in transcriptome analyses

    • Utilize strains with enhanced secretion capabilities

Research has shown that in E. nidulans, recombinant protein expression can trigger responses similar to the unfolded protein response. Monitoring markers of this response, such as the ER chaperone bipA and protein disulfide isomerase pdiA, can provide insights into whether protein folding is a limitation. Co-expression of these chaperones might enhance proper folding and secretion of recombinant TSC10.

What analytical methods are most effective for characterizing TSC10 enzymatic activity in vitro?

Comprehensive characterization of TSC10 activity requires multiple analytical approaches to measure both substrate consumption and product formation. The most effective methods include:

  • Spectrophotometric assays:

    • Continuous monitoring of NADPH oxidation at 340 nm

    • High-throughput capability for kinetic studies

    • Limited by spectral interference from crude samples

  • Chromatographic methods:

    • HPLC separation of substrate and product

    • LC-MS for increased sensitivity and specificity

    • Can be coupled with radioisotope labeling for enhanced detection

  • Mass spectrometry:

    • Direct analysis of reaction products

    • Liquid chromatography-high-resolution mass spectrometry (LC-HRMS) for precise quantification

    • Multiple reaction monitoring (MRM) for targeted analysis of known intermediates

For kinetic characterization, researchers should determine:

  • Km and Vmax for both 3-ketodihydrosphingosine and NADPH

  • Optimal pH and temperature

  • Effects of potential inhibitors

  • Substrate specificity using structural analogs

When examining the impact of mutations or comparing enzymes from different species, researchers should establish standardized activity assays that can detect subtle differences in catalytic efficiency. The stability of both substrate and product should be considered, as sphingolipid intermediates can be unstable under certain conditions.

How can molecular docking be used to study TSC10 interactions with substrates and inhibitors?

Molecular docking provides valuable insights into enzyme-substrate and enzyme-inhibitor interactions that can guide experimental design. For TSC10, molecular docking has been successfully used to identify bioactive compounds that can inhibit related enzymes.

A methodological approach to molecular docking studies of TSC10 includes:

  • Preparation steps:

    • Crystal structure preparation (removing water, adding hydrogens)

    • Defining the binding site (typically where NADPH and substrate bind)

    • Preparation of small molecule libraries with appropriate 3D conformations

    • Validation using known substrates or inhibitors if available

  • Docking protocol:

    • Selection of appropriate algorithms (flexible vs. rigid docking)

    • Establishment of scoring functions that account for key interactions

    • Consideration of protein flexibility, particularly in the "substrate loop" region

    • Integration of NADPH cofactor in the binding site

  • Analysis of results:

    • Clustering of docking poses

    • Evaluation of binding energy scores

    • Analysis of specific interactions (hydrogen bonds, hydrophobic contacts)

    • Comparison with experimental data when available

For validation of docking studies, researchers should consider follow-up experimental approaches such as site-directed mutagenesis of predicted contact residues, binding assays using purified protein, and enzyme inhibition studies with top-scoring compounds.

The crystal structure of TSC10 from Cryptococcus neoformans provides a valuable template for homology modeling of E. nidulans TSC10 if the structure is not directly available. When using this approach, researchers should carefully validate the model using techniques such as Ramachandran plot analysis and comparison of conserved regions.

What strategies can enhance the stability and solubility of recombinant TSC10 during expression and purification?

Enhancing stability and solubility of recombinant TSC10 is critical for obtaining sufficient quantities of active enzyme for biochemical and structural studies. Research-backed strategies include:

  • Fusion protein approaches:

    • N-terminal fusions: MBP (maltose-binding protein), GST (glutathione S-transferase)

    • C-terminal fusions: Consider impact on dimerization interfaces

    • Thioredoxin fusion to enhance disulfide bond formation

    • Inclusion of cleavable linkers for tag removal

  • Co-expression strategies:

    • Chaperones (bipA, pdiA) to assist folding

    • NADPH biosynthetic enzymes to increase cofactor availability

    • Other components of the sphingolipid biosynthetic pathway

  • Buffer optimization:

    • Screening buffering agents (HEPES, Tris, phosphate)

    • Addition of stabilizing agents (glycerol, trehalose)

    • Inclusion of reduced NADPH to stabilize enzyme structure

    • Detergents for solubilization if membrane-associated

  • Expression condition optimization:

    • Reduced temperature cultivation (20-25°C) to slow folding

    • Controlled induction to prevent overwhelming cellular machinery

    • Extended expression periods with continuous monitoring

Research on related enzymes from the SDR family suggests that maintaining the appropriate oligomeric state is crucial for activity. For TSC10, which predominantly forms dimers in solution with a minor tetrameric population, purification conditions should be optimized to preserve the native quaternary structure.

Researchers should systematically test these strategies using small-scale expression trials before scaling up, and include activity assays at each step to ensure the modified conditions preserve enzymatic function.

How should researchers approach conflicting data from different expression systems for TSC10?

When faced with conflicting data from different expression systems, researchers should implement a systematic analytical approach:

  • Data categorization and comparison:

    • Create a comprehensive table comparing key parameters (yield, activity, stability) across systems

    • Identify patterns in which specific properties are consistently affected by expression system

    • Distinguish between differences in enzymatic properties versus expression efficiency

  • Biochemical characterization across systems:

    • Standardize purification protocols to minimize system-specific artifacts

    • Compare kinetic parameters (Km, Vmax, substrate specificity) using identical assay conditions

    • Analyze post-translational modifications that might differ between systems

    • Assess oligomeric state in each system using techniques like size exclusion chromatography

  • Structural validation:

    • Compare protein folding using circular dichroism or thermal shift assays

    • Consider limited proteolysis to identify structural differences

    • If possible, obtain crystal structures from proteins expressed in different systems

  • Biological relevance assessment:

    • Compare properties to those of the native enzyme if available

    • Evaluate which system provides enzyme characteristics most similar to in vivo observations

    • Consider the intended application (structural studies, inhibitor screening, etc.)

Historical challenges with expression of related enzymes in E. coli and S. cerevisiae have included intracellular accumulation rather than efficient secretion. When comparing data from prokaryotic versus eukaryotic expression systems, researchers should consider fundamental differences in protein folding machinery and post-translational modifications.

What statistical approaches are most appropriate for analyzing TSC10 enzymatic activity data?

  • Kinetic parameter determination:

    • Nonlinear regression for Michaelis-Menten kinetics

    • Lineweaver-Burk, Eadie-Hofstee, or Hanes-Woolf plots for visualization

    • Bootstrap resampling for confidence interval estimation

    • Global fitting for complex kinetic models

  • Comparative analysis:

    • ANOVA for comparing multiple conditions or mutants

    • Student's t-test (paired or unpaired) for binary comparisons

    • Non-parametric tests (Mann-Whitney, Kruskal-Wallis) for non-normally distributed data

    • Multiple comparison corrections (Bonferroni, Tukey's HSD) when testing several hypotheses

  • Reproducibility assessment:

    • Calculation of intra-assay and inter-assay coefficients of variation

    • Power analysis to determine appropriate sample sizes

    • Meta-analysis techniques for combining data across studies

  • Advanced modeling:

    • Principal component analysis for multivariate data

    • Hierarchical clustering for identifying patterns in inhibitor studies

    • Machine learning approaches for complex structure-activity relationships

When reporting inhibition data for TSC10, researchers should clearly state the inhibition model used (competitive, noncompetitive, uncompetitive, or mixed) and provide appropriate statistical measures such as IC50 values with confidence intervals.

For publication, researchers should include detailed statistical methods, sample sizes, and raw data availability statements to ensure reproducibility. Graphical presentation should include error bars representing standard deviation or standard error as appropriate, with clear explanation in figure legends.

How might systems biology approaches advance our understanding of TSC10 function in the context of sphingolipid metabolism?

Systems biology offers powerful tools for understanding TSC10 within the broader context of sphingolipid metabolism and cellular function. Methodological approaches include:

  • Multi-omics integration:

    • Combining transcriptomics, proteomics, and metabolomics data

    • Temporal profiling during stress conditions that affect sphingolipid metabolism

    • Spatial analysis of TSC10 localization and interaction partners

    • Correlation of TSC10 expression with downstream metabolites

  • Flux analysis:

    • Isotope labeling to track sphingolipid precursors through biosynthetic pathways

    • Quantitative models of sphingolipid metabolism incorporating enzyme kinetics

    • Perturbation experiments with TSC10 inhibitors or genetic modifications

    • Computational simulation of metabolic networks

  • Network analysis:

    • Protein-protein interaction mapping using techniques like BioID or APEX

    • Genetic interaction screens (synthetic lethality, epistasis)

    • Regulatory network reconstruction identifying transcription factors controlling TSC10

    • Cross-species comparison of sphingolipid regulatory networks

  • Phenotypic profiling:

    • High-content screening with TSC10 mutations or inhibitors

    • Correlation of sphingolipid profiles with cellular phenotypes

    • Machine learning approaches to identify subtle phenotypic signatures

Transcriptome analysis of recombinant protein-expressing Aspergillus/Emericella strains has already revealed connections between protein production and cellular stress responses. Building on this foundation, researchers can explore how TSC10 activity influences and is influenced by these cellular networks.

Future research should focus on understanding not just the isolated enzyme but its place within dynamic cellular systems, potentially revealing new regulatory mechanisms and therapeutic opportunities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.