Recombinant Emericella nidulans Altered inheritance of mitochondria protein 31, mitochondrial (aim31)

Shipped with Ice Packs
In Stock

Description

Introduction

The fungus Emericella nidulans, also known as Aspergillus nidulans, possesses the capability to produce diverse natural products, including antibiotic compounds with polyketide and amino acid building blocks . One protein identified in Saccharomyces cerevisiae that displays a high degree of similarity to members of the Hig1 protein family is Aim31 . Aim31 was initially discovered through a screen to identify genes encoding proteins whose absence caused an altered inheritance of mtDNA (AIM) .

Aim31 Function and Characteristics

  • Aim31 is a member of the conserved hypoxia-induced gene 1 (Hig1) protein family .

  • It is a component of the yeast cytochrome bc1-cytochrome c oxidase (COX) supercomplex .

  • Aim31 partitions with the COX complex and may act as a bridge to the cytochrome bc1 complex .

  • It interacts with the Cox3 subunit, even before their assembly into the COX complex, and is in close proximity to members of the ADP/ATP carrier (AAC) family .

  • Aim31 shares functional overlap with another Hig1-related protein, Rcf2 (formerly Aim38), and their combined presence is essential for optimal COX enzyme activity and the correct assembly of the cytochrome bc1-COX supercomplex .

  • Both Aim31 and Aim38 can independently associate with the cytochrome bc1-COX supercomplex, suggesting the existence of at least two forms of this supercomplex within mitochondria .

  • The association with the cytochrome bc1-COX supercomplex and regulation of the COX complex is a conserved feature of Hig1 family members .

  • Aim31 displays a close physical relationship with the Cox3 protein .

Given their functional relevance for the COX enzyme and their physical association with the cytochrome bc 1-COX supercomplex, Aim31 and Aim38 have been proposed to be renamed Rcf1 and Rcf2, respectively, where Rcf stands for respiratory supercomplex factors .

Aim31 and the Cytochrome bc1-COX Supercomplex

Aim31 is found in association with the cytochrome bc1-COX supercomplex, binding to both the cytochrome bc1 and COX enzyme domains . It is more tightly associated with the COX complex . The presence of Aim31 and Aim38 proteins is required for the correct assembly of the cytochrome bc1-COX supercomplex, and they may act as bridges to support the assembly of the supercomplex state . Rcf1 (Aim31) is a cytochrome c oxidase subunit which plays a role in the assembly of respiratory supercomplexes .

Impact on COX Enzyme Activity

Loss of both Aim31 and Aim38 (but not loss of only one of them) has a significant impact on the COX enzyme activity and assembly of the peripheral COX subunits Cox12 and Cox13 . Hig1 proteins regulate COX enzyme activity through Cox3 and associated Cox12 protein, potentially influenced by neighboring AAC proteins .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rcf1; aim31; AN3831; Respiratory supercomplex factor 1, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-181
Protein Length
full length protein
Species
Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)
Target Names
rcf1
Target Protein Sequence
MSEPLPSSFDGHEQFQEETPLQKFGRRFKEEPWVPAVGLLGCAATCYALWRAYRSMKAGD SVEMNRMFRARIYAQGLTLLTVVAGGLYYRTERTQRREFEQALELRKGQEKRDAWLRELE IRDKEDKEWRERHAAIEAAAKQAGNKPVLAEQDAARSALEPSEQKYYGVLDAVRDLVSRR E
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit involved in the assembly of respiratory supercomplexes.

Database Links
Protein Families
RCF1 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is Emericella nidulans aim31 protein and what are its alternative nomenclatures?

Altered inheritance of mitochondria protein 31 (aim31) from Emericella nidulans is a mitochondrial protein also known as rcf1 (Respiratory supercomplex factor 1). Other synonyms include AN3831 in genomic databases. The protein is encoded by the rcf1 gene and has the UniProt identifier Q5B6J9. The full-length protein consists of 181 amino acids and functions in mitochondrial processes related to respiratory chain organization .

How is the taxonomic classification of Emericella nidulans currently understood?

Although the protein is referred to as originating from Emericella nidulans, it is important to note that taxonomic revisions have reclassified many Emericella species. Current fungal taxonomy has moved most Emericella species, including E. nidulans, to the genus Aspergillus (Ascomycota). The genus Emericella formerly included more than thirty species with worldwide distribution across numerous ecosystems and was recognized as a rich source of diverse metabolites. These taxonomic updates reflect improved understanding of phylogenetic relationships based on molecular data, but many research materials and databases may still use the former nomenclature .

What expression systems are most effective for producing recombinant aim31 protein?

For recombinant production of Emericella nidulans aim31 protein, E. coli expression systems have proven effective as demonstrated in commercial preparations. The protein can be successfully expressed as a full-length construct (1-181 amino acids) with an N-terminal His-tag to facilitate purification. The bacterial expression system yields functional protein that can be purified to greater than 90% purity as determined by SDS-PAGE analysis .

Alternative expression systems such as yeast (P. pastoris or S. cerevisiae) might offer advantages for expressing mitochondrial proteins with proper folding and post-translational modifications, but would require optimization of codon usage and signal sequences. When selecting an expression system, researchers should consider:

  • Yield requirements

  • Downstream application sensitivity to bacterial contaminants

  • Need for post-translational modifications

  • Protein solubility challenges

  • Scale of production required

What are the optimal storage and handling conditions for recombinant aim31 protein?

To maintain optimal activity and stability of recombinant aim31 protein, the following storage and handling conditions are recommended:

  • Store lyophilized powder at -20°C to -80°C upon receipt

  • Aliquot reconstituted protein to avoid repeated freeze-thaw cycles

  • For working samples, store aliquots at 4°C for up to one week

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration before long-term storage (50% is standard)

  • Briefly centrifuge vials prior to opening to bring contents to the bottom

  • Store in Tris/PBS-based buffer with 6% trehalose at pH 8.0

These conditions preserve protein stability and function over extended periods, which is critical for experimental reproducibility. Repeated freeze-thaw cycles should be strictly avoided as they can lead to protein degradation and loss of functional activity .

How can I design experiments to study aim31's role in mitochondrial inheritance?

To investigate aim31's role in mitochondrial inheritance, consider these experimental approaches:

  • Gene knockout/knockdown studies:

    • Generate aim31-deficient strains using CRISPR-Cas9 or RNAi approaches

    • Compare mitochondrial morphology, distribution, and inheritance patterns between wild-type and mutant strains using fluorescent labeling and live-cell imaging

  • Protein localization analysis:

    • Use fluorescent protein tagging or immunofluorescence to track aim31 distribution within mitochondria

    • Employ super-resolution microscopy to precisely map protein localization

  • Interaction partner identification:

    • Perform co-immunoprecipitation followed by mass spectrometry

    • Use yeast two-hybrid or proximity labeling methods to identify protein-protein interactions

  • Functional assessment:

    • Measure mitochondrial respiration rates and membrane potential in wild-type versus aim31-deficient cells

    • Assess respiratory supercomplex stability and assembly using blue native PAGE

  • Intergenerational effect analysis:

    • Design breeding experiments with aim31 mutant organisms to track mitochondrial inheritance patterns across generations

    • Implement methods similar to those used in studies of diet-induced mitochondrial dysfunction to evaluate whether aim31 mutations influence offspring metabolic parameters

This experimental framework provides comprehensive assessment of aim31's function in mitochondrial dynamics and inheritance.

How does aim31 potentially contribute to intergenerational mitochondrial signaling?

Recent research has revealed that mitochondrial proteins can influence intergenerational signaling through mechanisms involving mitochondrial tRNAs (mt-tRNAs). While aim31/rcf1 has not been specifically identified in these pathways, investigations of similar mitochondrial proteins suggest potential involvement in such processes.

Studies of paternal mitochondrial dysfunction in mouse models have demonstrated that mutations in mitochondrial proteins can lead to the accumulation of mitochondrial tRNAs in sperm, which are then transferred to oocytes during fertilization. These mt-tRNAs have been shown to influence embryonic gene expression, particularly for genes involved in oxidative metabolism, which can predispose offspring to metabolic disorders such as glucose intolerance .

The International Mouse Phenotyping Consortium (IMPC) has found that paternal heterozygosity for genes involved in mitochondrial structure and function, including mitochondrial ribosomal proteins (Mrpl23) and NADH:ubiquinone oxidoreductase components (Ndufb8), can reprogram offspring metabolism. These effects appear to be mediated through changes in sperm mt-tRNAs .

As aim31/rcf1 functions in mitochondrial respiratory chain organization, it could potentially participate in similar signaling mechanisms. Researchers interested in this aspect might design experiments to:

  • Assess whether aim31 mutations affect mt-tRNA profiles in reproductive cells

  • Determine if aim31 dysfunction correlates with altered metabolism in offspring

  • Investigate potential interactions between aim31 and known components of mitochondrial RNA processing machinery

What methodologies are appropriate for studying aim31's potential involvement in respiratory supercomplex assembly?

To investigate aim31's role in respiratory supercomplex assembly, researchers should employ a multi-faceted approach:

  • Blue Native PAGE (BN-PAGE):

    • Isolate mitochondria from wild-type and aim31-deficient cells

    • Solubilize mitochondrial membranes with mild detergents (digitonin)

    • Separate respiratory complexes under native conditions

    • Perform in-gel activity assays to assess functional integrity of complexes

  • Cryo-electron microscopy (Cryo-EM):

    • Purify respiratory supercomplexes from wild-type and aim31-deficient mitochondria

    • Determine structural differences using high-resolution cryo-EM

    • Create 3D reconstructions to identify aim31's position within supercomplexes

  • Oxygen consumption measurements:

    • Use high-resolution respirometry (Oroboros or Seahorse analyzers)

    • Measure substrate-specific respiration rates

    • Assess the impact of aim31 deficiency on respiratory efficiency

  • Crosslinking mass spectrometry:

    • Apply protein crosslinkers to stabilize transient interactions

    • Identify aim31's binding partners within the respiratory chain

    • Map interaction surfaces using targeted mutagenesis

  • Computational modeling:

    • Predict aim31's structure and interaction interfaces

    • Simulate dynamic interactions with respiratory complex components

    • Guide experimental design for validation studies

These approaches collectively provide comprehensive insights into aim31's functional role in respiratory supercomplex assembly and stability.

What are common issues when working with recombinant aim31 protein and how can they be resolved?

Researchers working with recombinant aim31 protein may encounter several technical challenges:

  • Protein aggregation:

    • Problem: Hydrophobic transmembrane regions can cause aggregation

    • Solution: Add mild detergents (0.1% DDM or 0.5% CHAPS) to maintain solubility; optimize buffer conditions; consider using stabilizing agents like trehalose

  • Low expression yields:

    • Problem: Mitochondrial proteins often express poorly in heterologous systems

    • Solution: Optimize codon usage for expression host; reduce induction temperature (16-20°C); try fusion partners that enhance solubility (MBP, SUMO); consider cell-free expression systems

  • Improper folding:

    • Problem: Incorrect disulfide bond formation or protein conformation

    • Solution: Include molecular chaperones during expression; use redox buffer systems during purification; attempt refolding from inclusion bodies if necessary

  • Functional activity loss:

    • Problem: Protein loses activity during purification or storage

    • Solution: Minimize purification steps; include stabilizing agents (glycerol, trehalose); store in small aliquots to avoid freeze-thaw cycles; consider activity assays to monitor protein functionality

  • Contaminating proteases:

    • Problem: Proteolytic degradation during expression or purification

    • Solution: Add protease inhibitors; reduce purification time; keep samples cold; consider protease-deficient expression hosts

Implementing these solutions can significantly improve the quality and yield of recombinant aim31 protein for downstream applications.

How can researchers address the challenges of studying mitochondrial protein interactions in vivo?

Studying mitochondrial protein interactions in living systems presents unique challenges. To overcome these obstacles when investigating aim31 interactions:

  • Mitochondrial isolation complications:

    • Challenge: Maintaining intact mitochondria with preserved protein interactions

    • Solution: Use gentle isolation methods with isotonic buffers; perform rapid isolations at 4°C; validate mitochondrial integrity using marker enzymes

  • Distinguishing direct from indirect interactions:

    • Challenge: Determining whether proteins interact directly or as part of larger complexes

    • Solution: Implement proximity-dependent labeling methods (BioID, APEX); use FRET/BRET for live-cell interaction detection; perform reconstitution studies with purified components

  • Temporal dynamics of interactions:

    • Challenge: Capturing transient or condition-dependent interactions

    • Solution: Utilize synchronized cellular systems; apply rapid crosslinking approaches; develop real-time imaging of fluorescently tagged proteins

  • Subcellular localization precision:

    • Challenge: Accurately mapping interactions to subcompartments within mitochondria

    • Solution: Apply correlative light and electron microscopy (CLEM); use super-resolution microscopy techniques; implement mitochondrial subcompartment-targeted reporters

  • Genetic manipulation limitations:

    • Challenge: Difficulty modifying essential mitochondrial genes

    • Solution: Develop conditional knockout systems; use degron-based approaches for temporal control; implement precise genome editing with CRISPR-Cas9

By addressing these challenges with appropriate methodologies, researchers can obtain more reliable and physiologically relevant data on aim31's interactions within the mitochondrial environment.

How should researchers interpret contradictory results regarding aim31's function across different model systems?

When encountering contradictory results about aim31's function across different experimental models, consider these analytical approaches:

  • Systematic comparative analysis:

    • Create a comprehensive table comparing experimental conditions, genetic backgrounds, and methodologies

    • Identify variables that correlate with different outcomes

    • Implement standardized protocols across systems for direct comparison

  • Evolutionary context evaluation:

    • Analyze conservation of aim31 sequence and structure across species

    • Consider if functional divergence explains different phenotypic outcomes

    • Examine the evolutionary history of interacting partners across model systems

  • Compensatory mechanism assessment:

    • Investigate potential redundant proteins that may mask phenotypes in certain systems

    • Perform double-knockout studies of aim31 and related family members

    • Analyze expression profiles of related proteins in different models

  • Tissue-specific and developmental timing factors:

    • Determine if contradictions relate to tissue-specific functions

    • Evaluate whether developmental timing of aim31 activity varies between models

    • Consider using conditional systems to control spatial and temporal expression

  • Technical validation across platforms:

    • Reproduce key experiments using identical reagents and protocols

    • Implement orthogonal approaches to validate contentious findings

    • Consider collaborative cross-laboratory validation studies

This structured approach helps distinguish genuine biological variations from technical artifacts, leading to more nuanced understanding of aim31's context-dependent functions.

What statistical approaches are most appropriate for analyzing mitochondrial inheritance patterns in aim31 studies?

For robust statistical analysis of mitochondrial inheritance patterns in aim31 research, consider these approaches:

  • Quantitative trait analysis:

    • Implement linear mixed models to account for maternal and paternal effects

    • Use variance component analysis to partition genetic vs. environmental factors

    • Apply quantile regression for examining effects across the distribution of phenotypes

  • Time-series analysis for dynamic processes:

    • Employ repeated measures ANOVA for longitudinal studies

    • Implement time-series clustering to identify inheritance pattern groups

    • Use state-space models to capture temporal dynamics of mitochondrial distributions

  • Multi-generational inheritance modeling:

    • Apply Bayesian hierarchical models to capture generational dependencies

    • Implement Markov chain analysis for transition probabilities between states

    • Use permutation tests to assess significance of inheritance patterns

  • Spatial statistics for mitochondrial distribution:

    • Apply nearest-neighbor analysis to quantify mitochondrial clustering

    • Use Ripley's K-function to characterize spatial distribution patterns

    • Implement image-based machine learning for automated classification

  • Meta-analytical approaches:

    • Conduct formal meta-analysis when combining results across studies

    • Implement random-effects models to account for between-study heterogeneity

    • Use funnel plots and Egger's test to assess publication bias

These statistical approaches provide rigorous frameworks for analyzing complex mitochondrial inheritance data, accounting for biological variability while maintaining sufficient statistical power to detect relevant effects.

What emerging technologies could advance our understanding of aim31's role in mitochondrial function?

Several cutting-edge technologies offer promising avenues for deeper exploration of aim31's mitochondrial functions:

  • Mitochondria-specific CRISPR screening:

    • Implement mitochondria-targeted CRISPR-Cas9 systems for organelle-specific genome editing

    • Perform high-throughput screens using mitochondrial function readouts

    • Identify genetic interactions through combinatorial guide RNA libraries

  • Single-cell multi-omics approaches:

    • Apply integrated proteomics, transcriptomics, and metabolomics at single-cell resolution

    • Correlate aim31 expression with mitochondrial functional parameters

    • Identify cell-to-cell variability in aim31-dependent processes

  • Live-cell mitochondrial imaging innovations:

    • Utilize genetically encoded sensors for mitochondrial parameters (membrane potential, calcium, ROS)

    • Implement lattice light-sheet microscopy for extended live imaging with minimal phototoxicity

    • Apply optogenetic tools to manipulate aim31 function with spatiotemporal precision

  • Mitochondrial interactome mapping:

    • Implement proximity-dependent biotinylation techniques optimized for mitochondrial compartments

    • Apply cross-linking mass spectrometry for capturing transient interactions

    • Develop organelle-specific split protein complementation assays

  • Synthetic biology approaches:

    • Engineer minimal mitochondrial systems with defined components

    • Create chimeric aim31 proteins to dissect domain-specific functions

    • Develop inducible protein degradation systems specific to mitochondrial proteins

These technological advances will enable more precise manipulation and measurement of aim31 function, potentially revealing previously uncharacterized roles in mitochondrial dynamics and inheritance.

How might aim31 research contribute to understanding broader questions about mitochondrial involvement in epigenetic inheritance?

Research on aim31 could significantly advance our understanding of mitochondrial contributions to epigenetic inheritance through several promising avenues:

  • Mechanism elucidation of mt-tRNA processing:

    • Investigate whether aim31 influences mitochondrial tRNA biogenesis or fragmentation

    • Determine if aim31 dysfunction alters the profile of sperm-borne mt-tRNAs

    • Explore potential interactions between aim31 and RNA processing machinery

  • Metabolic reprogramming pathways:

    • Assess how aim31 mutations affect cellular metabolism and resulting metabolite profiles

    • Investigate whether these metabolic changes influence epigenetic modifications

    • Determine if aim31-dependent metabolic signatures persist across generations

  • Interorganelle communication mechanisms:

    • Explore aim31's potential role in mitochondria-nucleus signaling

    • Investigate whether aim31 dysfunction alters nuclear gene expression patterns

    • Examine how these communication pathways might influence gamete formation

  • Stress response coordination:

    • Determine whether aim31 participates in mitochondrial stress responses

    • Investigate if these responses generate signals that can be transmitted to offspring

    • Explore potential parallels with known mitochondrial dysfunction models that show intergenerational effects

  • Integration with other epigenetic pathways:

    • Examine interactions between aim31-dependent mitochondrial signaling and established epigenetic mechanisms

    • Investigate potential synergies with histone modifications or DNA methylation patterns

    • Develop integrated models of mitochondrial-nuclear epigenetic regulation

This research direction is particularly relevant given recent findings that mitochondrial dysfunction induced either by diet or genetic manipulation can transmit metabolic phenotypes to offspring through alteration of sperm mt-tRNAs . Understanding aim31's potential role in these processes could provide valuable insights into the broader field of non-genetic inheritance.

Table 1: Key Properties of Recombinant Emericella nidulans aim31 Protein

PropertyDescriptionReference
Gene Namercf1
Synonymsaim31, AN3831, Respiratory supercomplex factor 1, mitochondrial
UniProt IDQ5B6J9
Protein Length181 amino acids
Expression SystemE. coli
Purification TagN-terminal His-tag
Storage FormLyophilized powder
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Recommended Storage-20°C/-80°C, avoid repeated freeze-thaw cycles
Reconstitution0.1-1.0 mg/mL in deionized sterile water

Table 2: Comparative Analysis of Mitochondrial Protein Studies Relevant to aim31 Research

Mitochondrial ProteinObserved Phenotype in Heterozygous KnockoutSperm mt-tRNA EffectOffspring Metabolic EffectReference
Mrpl23Mitochondrial ribosomal dysfunctionAccumulation of 5′ mt-tsRNAsIncreased adiposity, glucose intolerance
Ndufb8NADH:ubiquinone oxidoreductase dysfunctionAccumulation of 5′ mt-tsRNAsReprogrammed offspring glucose metabolism
TsfmTranslation elongation factor dysfunctionNo significant mt-tsRNA changesNo significant metabolic reprogramming
aim31/rcf1Not directly studied in intergenerational contextResearch opportunityResearch opportunity-

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.