Recombinant Emericella nidulans ATP synthase subunit a (atp6)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characteristics

ATP synthase subunit a (atp6) is encoded by the atp6 gene and functions as a proton channel within the mitochondrial inner membrane. In its recombinant form, it is expressed in heterologous systems such as E. coli, yeast, or mammalian cells . Key features include:

  • Gene Information: The atp6 gene overlaps with MT-ATP8 in mitochondrial DNA, complicating its expression regulation .

  • Protein Structure:

    • Contains hydrophobic domains critical for proton translocation .

    • Partial sequences (e.g., residues 9–256) are commonly expressed for functional studies .

  • Post-Translational Modifications: Requires chaperones like Atp10 and Atp23 for proper folding and integration into ATP synthase .

3.1. Mechanistic Studies of ATP Synthase

Recombinant atp6 enables dissection of ATP synthase assembly and function:

  • Proton Channel Dynamics: Mutations in atp6 (e.g., m.8950G>A, p.V142I) disrupt proton flow, linking structural variants to bioenergetic deficits .

  • Assembly Pathways: Atp6 forms a transient complex with Atp8 and stator subunits (e.g., Atp4, Atp7) before integrating into the FO_O domain .

3.2. Disease Modeling

Pathogenic atp6 variants are implicated in mitochondrial disorders:

VariantClinical PhenotypeFunctional Defect
m.8932C>T (p.P136S)Leigh syndrome, neuropathyImpaired ATP synthesis; reduced enzyme stability
m.9035T>C (p.L170P)Encephalopathy, lactic acidosisROS overproduction; oxidative stress

4.2. Biogenesis Regulation

  • Translation Control: Atp6 synthesis is upregulated in response to assembly defects, suggesting feedback mechanisms .

  • Chaperone Dependence: Atp10 stabilizes nascent atp6, ensuring proper interaction with the c-ring .

Challenges and Future Directions

  • Expression Optimization: Full-length atp6 expression remains challenging due to hydrophobicity .

  • Therapeutic Targeting: Understanding atp6 mutations may guide gene therapy for mitochondrial diseases .

Recombinant Emericella nidulans atp6 continues to be indispensable for probing ATP synthase mechanics and mitochondrial pathology, bridging structural biology and clinical research.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our inventory. However, if you have specific requirements for the format, please include your request in the order notes. We will do our best to accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributor.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference for your use.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquotting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is finalized during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atp6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
9-256
Protein Length
Full Length of Mature Protein
Species
Emericella nidulans (Aspergillus nidulans)
Target Names
atp6
Target Protein Sequence
SPLDQFEIRDLFSLNANVLGNIHLSITNIGLYLSIGLLLTLGYHLLAANNKIIPNNWSIS QEAIYATVHSIVINQLNPTKGQLYFPFIYALFIFILVNNLIGMVPYSFASTSHFILTFSM SFTIVLGATFLGLQRHGLKFFSLFVPSGCPLGLLPLLVLIEFISYLSRNVSLGLRLAANI LSGHMLLSILSGFTYNIMTSGILFFFLGLIPLAFIIAFSGLELAIAFIQAQVFVVLTCSY IKDGLDLH
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) generates ATP from ADP in the presence of a proton gradient across the membrane, which is established by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel. These domains are connected by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled to proton translocation through a rotary mechanism of the central stalk subunits. This subunit is a key component of the proton channel and potentially plays a direct role in proton translocation across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the taxonomic relationship between Emericella nidulans and Aspergillus nidulans?

Emericella nidulans represents the sexual (teleomorph) form of Aspergillus nidulans, which is the asexual (anamorph) stage of the same organism. This filamentous fungus serves as an important model organism for the Aspergilli group, which encompasses human and plant pathogens as well as industrial cell factories with highly diversified metabolism . Understanding this taxonomic relationship is critical when searching literature and databases, as research may be published under either name depending on which form was studied or when the research was conducted.

What are the optimal conditions for expressing recombinant E. nidulans ATP synthase subunit a?

For heterologous expression of E. nidulans ATP synthase subunit a, researchers should consider the following methodological approach:

  • Expression system selection: Due to the membrane-bound nature of this protein, expression systems capable of proper membrane protein folding are recommended. Common systems include:

    • Specialized E. coli strains (C41/C43)

    • Yeast expression systems (P. pastoris)

    • Cell-free systems for difficult membrane proteins

  • Optimization parameters:

    ParameterRecommended ConditionsRationale
    Induction temperature18-25°CSlower expression improves folding
    Induction timeExtended (24-48h)Allows proper membrane integration
    Detergent selectionMild non-ionic detergentsPreserves native structure
    Purification bufferTris-based with glycerolStabilizes protein structure
  • Verification: Western blotting with anti-ATP synthase antibodies and mass spectrometry analysis to confirm successful expression.

Note that expression systems should be selected based on downstream applications, with special consideration for maintaining the native conformation of this membrane protein.

What storage conditions maximize stability of recombinant E. nidulans ATP synthase subunit a?

For maximum stability, recombinant E. nidulans ATP synthase subunit a should be stored in Tris-based buffer with 50% glycerol at -20°C for routine storage or -80°C for extended preservation . For working aliquots, 4°C storage is suitable for up to one week. Repeated freeze-thaw cycles significantly reduce protein activity and should be strictly avoided . The addition of protease inhibitors and antioxidants to storage buffers may further enhance stability.

How can transcriptomic approaches be applied to study ATP synthase expression in E. nidulans?

Transcriptomic analysis of E. nidulans ATP synthase components can be effectively conducted using the following methodology:

  • Growth conditions: Cultivate E. nidulans in well-controlled bioreactors under varying conditions to induce metabolic shifts. For example, growing cells on different carbon sources (glucose, glycerol, and ethanol) results in different regulatory responses and metabolic network configurations .

  • RNA extraction and analysis: Extract high-quality RNA followed by genome-wide transcription analysis using oligonucleotide arrays containing probes for the complete set of putative genes (including atp6) in the E. nidulans genome.

  • Data interpretation:

    • Map differential expression of ATP synthase subunits across conditions

    • Correlate expression changes with shifts in central carbon metabolism

    • Integrate findings with other cellular processes

This approach enables researchers to understand how energy production via ATP synthase is coordinated with broader metabolic changes, particularly during shifts between fermentative and respiratory metabolism .

How does the metabolic network of E. nidulans influence ATP synthase function?

E. nidulans possesses a highly diversified metabolism, with recent metabolic network reconstructions linking 666 genes to metabolic functions . ATP synthase function is intricately connected to this network through:

  • Carbon source utilization: Different carbon sources (glucose, glycerol, ethanol) enter central carbon metabolism at different points, affecting the rate of NADH production and subsequently, electron transport chain activity and ATP synthesis.

  • Metabolic shifts: When E. nidulans shifts from glucose to ethanol as a carbon source, cells transition from using the pentose phosphate pathway to the malic enzyme as the primary source of NADPH . This shift affects redox balance and energy production pathways.

  • Regulatory mechanisms: Coordinated regulation occurs across metabolic pathways. For example, during a shift from glucose to ethanol, upregulation of gluconeogenesis occurs alongside downregulation of glycolysis and pentose phosphate pathway . These changes directly impact ATP synthase substrate availability.

What approaches can be used to study protein-protein interactions involving ATP synthase subunit a in E. nidulans?

To investigate protein-protein interactions involving ATP synthase subunit a in E. nidulans, researchers should consider these methodological approaches:

  • Co-immunoprecipitation (Co-IP):

    • Generate antibodies against recombinant ATP synthase subunit a

    • Perform pull-down assays with mitochondrial fractions

    • Identify interaction partners via mass spectrometry

  • Proximity labeling techniques:

    • BioID or APEX2 fusion proteins for in vivo labeling

    • Express ATP synthase subunit a-BioID fusion in E. nidulans

    • Identify proximal proteins through streptavidin pull-down and MS analysis

  • Crosslinking mass spectrometry (XL-MS):

    • Apply chemical crosslinkers to stabilize transient interactions

    • Digest and analyze by MS to identify interaction sites

    • Model spatial relationships between ATP synthase components

  • Bimolecular Fluorescence Complementation (BiFC):

    • Generate split fluorescent protein fusions

    • Monitor protein interactions through microscopy

    • Validate interactions observed through other methods

These approaches provide complementary information about both the structural organization of the ATP synthase complex and potential regulatory interactions.

How does ATP synthase research in E. nidulans relate to secondary metabolite production?

E. nidulans produces various secondary metabolites, including emericellamide A, an antibiotic compound with both polyketide and amino acid building blocks . ATP synthase research connects to secondary metabolism through:

  • Energy requirements: Secondary metabolite biosynthesis is energetically expensive, requiring significant ATP input. ATP synthase efficiency directly impacts the cell's capacity to produce these compounds.

  • Regulatory coordination: Genomic studies in E. nidulans have revealed coordinated regulation between primary metabolism (including energy production) and secondary metabolite gene clusters. For example, the emericellamide biosynthetic pathway includes polyketide synthases that require ATP for activation .

  • Metabolic engineering applications: Understanding ATP synthase regulation provides opportunities to enhance secondary metabolite production through:

    • Optimization of ATP availability during fermentation

    • Engineering of ATP synthase expression to coincide with secondary metabolite production phases

    • Integration of ATP production metrics into metabolic models for strain improvement

What genetic manipulation techniques are most effective for studying ATP synthase in E. nidulans?

For genetic studies of ATP synthase in E. nidulans, several methodological approaches have proven effective:

  • Gene deletion strategies:

    • Recently developed gene targeting techniques enable efficient gene deletion in E. nidulans

    • For essential genes like ATP synthase components, conditional systems such as repressible promoters should be employed

  • Promoter replacement:

    • Native promoters can be replaced with either inducible or strong constitutive promoters

    • This approach allows controlled expression of ATP synthase components

  • Site-directed mutagenesis:

    • Targeted mutations can identify critical residues for ATP synthase function

    • CRISPR-Cas9 systems adapted for filamentous fungi enable precise genome editing

  • Reporter gene fusions:

    • Tagging ATP synthase components with fluorescent proteins enables localization studies

    • Promoter-reporter fusions allow monitoring of transcriptional regulation

These genetic approaches, combined with biochemical and physiological analyses, provide powerful tools for comprehensively understanding ATP synthase biology in this model filamentous fungus.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.