Recombinant Emericella nidulans Chitin synthase export chaperone (chs7)

Shipped with Ice Packs
In Stock

Description

Biological Function

Chs7 belongs to the Shr3-like chaperone family and is indispensable for chitin synthase (CHS) trafficking:

  • ER Export: Chs7 ensures CHS enzymes exit the ER. In its absence, CHS accumulates in the ER, impairing chitin synthesis .

  • Fungal-Specific Role: Unlike yeast (single CHS7 gene), filamentous fungi like Neurospora crassa have paralogs (CSE-7 and CSE-8) with specialized roles. CSE-8, homologous to Chs7, directs CHS-3 to hyphal tips and septa .

  • Developmental Impact: Knockout strains of Chs7 homologs exhibit defects in hyphal growth, sporulation, and cell wall integrity .

3.1. Mechanistic Insights

  • Yeast Studies: In Saccharomyces cerevisiae, Chs7 regulates Chs3p (CHS-III) export. Co-overexpression of CHS3 and CHS7 boosts chitin synthesis by 300%, confirming Chs7 as a limiting factor .

  • Filamentous Fungi: In Neurospora crassa, CSE-8 (Chs7 homolog) deficiency disrupts CHS-3 localization at the Spitzenkörper, reducing GlcNAc content by 40% and radial growth by 60% .

3.2. Enzyme Interactions

  • Chitin Synthase Activation: Chs7 partners with CHS-III class enzymes, which synthesize linear β-1,4-linked GlcNAc polymers. This interaction is critical for cell wall plasticity .

  • Stress Response: ER stressors (e.g., tunicamycin) alter Chs7-GFP and CHS-3-GFP distribution, highlighting ER retention mechanisms .

Applications

  • Antifungal Targets: Chs7 is a potential target for antifungal agents, as chitin synthesis is absent in humans .

  • Biotechnological Tool: Recombinant Chs7 enables studies on CHS trafficking and fungal morphogenesis .

  • Protein Interaction Studies: Used to map binding domains of CHS enzymes and auxiliary regulators .

Key Research References

  1. ER Export Mechanism

  2. Structural Characterization

  3. Fungal Development Studies

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
chs7; AN1069; Chitin synthase export chaperone
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-331
Protein Length
full length protein
Species
Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)
Target Names
chs7
Target Protein Sequence
MGFGDFDEICKKAALPLCSLVGPSSAISGSTGIIPNCYARNIELANTIIFEGAASFLHII ALGMTVIMILHIRSKFTAVGRKEIITFFYIYMALTVCSLVIDAGVVPPRSGPFPWFVAVQ NGLTSALCTSLLVNGFVGFQLYEDGTALSVWLLRLTSTVMFAVSFLISILTFKSWGGLSP TNTLAMFIVLYIINAICIAVYLVMQLLLVLNTLEDRWPLGHIAFGLLVFIAGQVIMYAFG DVICDNVQHYLDGLFFATFCNLLAVMMVYKFWDYITKEDLEFSVGIKPNNWEIKELLPDE DRRTTVYQDTNSEYAGSMYHHRASTYNGHGY
Uniprot No.

Target Background

Function
This protein functions as a chaperone, essential for the export of the chitin synthase chs3 from the endoplasmic reticulum.
Database Links
Protein Families
CHS7 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the role of Chs7 in chitin synthesis in Emericella nidulans?

Chs7 functions as an export chaperone that specifically facilitates the exit of chitin synthases from the endoplasmic reticulum (ER). After synthesis and folding in the ER, chitin synthases depend on Chs7 for proper ER exit and subsequent transport to the Golgi . Without this chaperone, chitin synthases would accumulate in the ER, resulting in reduced chitin synthesis and potential cell wall defects. The interaction between Chs7 and chitin synthases represents a critical quality control checkpoint in the secretory pathway of E. nidulans, ensuring that only properly folded enzymes reach their functional destinations.

How does Chs7 differ from other export chaperones in the fungal secretory pathway?

Chs7 belongs to a specialized class of export chaperones that show substrate specificity, unlike general chaperones involved in protein folding. While general cargo receptors like Erv14 mediate the export of various membrane proteins, Chs7 demonstrates specificity for chitin synthases . This specificity suggests that Chs7 recognizes unique structural features of chitin synthases that general chaperones cannot adequately address. The presence of such dedicated export machinery underscores the evolutionary importance of properly regulated chitin synthesis in fungal survival.

What is the relationship between Chs7 function and chitin synthase oligomerization?

Research indicates that chitin synthases, particularly Chs3 in Saccharomyces cerevisiae, undergo oligomerization through their N-terminal cytosolic regions . This oligomerization appears to be monitored at the Golgi level as part of quality control mechanisms. While Chs7 is required for ER exit, proper oligomerization influences subsequent trafficking steps. Oligomerization-deficient chitin synthases that reach the plasma membrane show altered enzymatic activity and endocytic recycling properties . This suggests that Chs7 may play a role not only in ER export but potentially in facilitating proper conformational arrangements that enable subsequent oligomerization.

What are the critical domains in Chs7 required for specific recognition of chitin synthases?

While the search results don't specify the exact domains of Chs7 involved in chitin synthase recognition, researchers can approach this question through systematic mutagenesis studies. Domain mapping would typically involve creating a series of deletion constructs or point mutations in recombinant Chs7, followed by binding assays with its chitin synthase partners. Based on the interaction patterns observed in other ER export chaperones, hydrophobic interactions likely play a significant role, possibly involving transmembrane domains or amphipathic helices. Co-immunoprecipitation experiments with tagged versions of both proteins could help identify the interaction interfaces.

What expression systems are optimal for producing functional recombinant E. nidulans Chs7?

For membrane-associated proteins like Chs7, several expression systems can be considered:

  • Homologous expression in A. nidulans: This maintains the native cellular environment but may yield limited protein quantities. Cultivation would follow established protocols, including glucose minimal medium (6 g/L NaNO₃, 0.52 g/L KCl, 0.52 g/L MgSO₄·7H₂O, 1.52 g/L KH₂PO₄, 10 g/L D-glucose, trace element solution) supplemented with pyridoxine (0.5 μg/mL) at 37°C .

  • Heterologous expression in S. cerevisiae: Given the similarity in secretory pathways between these fungi, S. cerevisiae offers advantages of higher growth rates and established genetic tools.

  • Insect cell systems: For larger quantities of properly folded membrane proteins, Sf9 or High Five insect cells can be effective, particularly when combined with baculovirus expression vectors.

Each system requires optimization of expression conditions, including temperature, induction time, and medium composition to maximize functional protein yield while minimizing aggregation.

What purification strategies yield high-quality recombinant Chs7 suitable for structural studies?

Purification of membrane-associated proteins like Chs7 presents significant challenges. A successful approach might include:

  • Detergent screening: Test multiple detergents (DDM, LMNG, CHAPS) for optimal solubilization while maintaining protein stability and function.

  • Affinity chromatography: Engineer recombinant Chs7 with affinity tags (His₆, FLAG) positioned to avoid interference with function, followed by IMAC or antibody-based purification.

  • Size exclusion chromatography: Remove aggregates and ensure monodispersity of the purified protein.

  • Stability optimization: Screen buffer conditions (pH 6.5-8.0, salt concentration 100-500 mM) and additives (glycerol, cholesterol) to enhance protein stability.

For structural studies, consider reconstituting purified Chs7 into nanodiscs or amphipols, which better mimic the native membrane environment compared to detergent micelles.

How can researchers effectively detect Chs7-chitin synthase interactions in vitro and in vivo?

Several complementary approaches can be used to characterize Chs7-chitin synthase interactions:

In vitro methods:

  • Pull-down assays: Using tagged recombinant proteins to identify direct binding.

  • Surface plasmon resonance (SPR): For quantitative measurement of binding kinetics.

  • Microscale thermophoresis (MST): To determine binding affinities in solution.

In vivo methods:

  • Bimolecular fluorescence complementation (BiFC): Split fluorescent proteins fused to Chs7 and chitin synthase reconstitute fluorescence when interactions occur.

  • Fluorescence resonance energy transfer (FRET): Measure proximity between fluorescently labeled proteins in living cells.

  • Co-immunoprecipitation: Isolate protein complexes from cellular lysates.

These approaches should be combined with mutational analyses targeting specific domains to map interaction interfaces precisely.

How can researchers distinguish between direct and indirect effects when analyzing Chs7 knockout phenotypes?

Distinguishing direct from indirect effects in Chs7 deletion strains requires multiple experimental approaches:

  • Complementation studies: Reintroducing wild-type Chs7 should rescue direct phenotypes. Time-course studies of phenotype restoration can reveal primary versus secondary effects.

  • Conditional expression systems: Using inducible promoters to control Chs7 expression allows observation of immediate effects upon depletion.

  • Specific interaction disruption: Creating point mutations that specifically disrupt Chs7-chitin synthase interactions while maintaining protein stability.

  • Comparative phenotypic analysis: Compare Chs7 deletion phenotypes with those of chitin synthase deletions to identify commonalities and differences.

  • Subcellular localization studies: Track the localization of chitin synthases in wild-type versus Chs7 knockout strains to confirm retention in the ER.

What analytical techniques provide the most reliable quantification of cell wall chitin content in Chs7 mutant strains?

Several complementary techniques offer reliable quantification of cell wall chitin:

Table 1: Analytical Methods for Chitin Quantification

MethodPrincipleAdvantagesLimitations
Calcofluor White StainingFluorescent dye binding to chitinSimple, rapid visualizationSemi-quantitative, affected by cell wall accessibility
HPLC AnalysisSeparation of hydrolyzed glucosamineHighly quantitative, specificRequires specialized equipment, complex sample preparation
Enzymatic AssayChitinase digestion followed by colorimetric detectionSpecific for chitinMay be affected by other cell wall components
Electron MicroscopyDirect visualization of cell wall ultrastructureReveals spatial distributionLabor-intensive, limited quantification
FTIR SpectroscopyInfrared absorption patterns of cell wallNon-destructive, rapidComplex spectra interpretation

For comprehensive analysis, researchers should combine multiple methods. For example, calcofluor white staining provides rapid screening, while HPLC analysis of acid-hydrolyzed cell walls offers precise quantification of glucosamine, the building block of chitin .

How should researchers interpret conflicting data between in vitro and in vivo studies of Chs7 function?

Discrepancies between in vitro and in vivo results are common when studying membrane proteins like Chs7. Consider these interpretation strategies:

  • Evaluate system limitations: In vitro systems may lack essential cofactors or membrane environments present in vivo.

  • Examine concentration effects: Protein concentrations in reconstituted systems often differ from physiological levels, potentially affecting interaction kinetics.

  • Consider redundancy mechanisms: Other proteins may compensate for Chs7 deficiency in vivo, masking phenotypes.

  • Assess temporal dynamics: In vivo systems involve complex regulatory networks operating on different timescales.

  • Inspect technical variables: Differences in protein tagging, expression levels, or experimental conditions may explain discrepancies.

When facing conflicting data, researchers should develop hypotheses that accommodate both observations and design experiments to directly test these explanations.

What are the promising approaches for developing Chs7 inhibitors as potential antifungal agents?

While commercial applications lie outside the scope of this academic FAQ, from a research perspective, Chs7 inhibitors could offer selective antifungal activity:

  • Structure-based drug design: Once the three-dimensional structure of Chs7 is determined, virtual screening can identify compounds that might disrupt its interaction with chitin synthases.

  • High-throughput screening: Developing fluorescence-based assays to monitor Chs7-chitin synthase interactions would enable screening of compound libraries.

  • Peptidomimetics: Designing peptides that mimic binding interfaces could competitively inhibit natural interactions.

  • Comparative analysis: Exploiting structural differences between fungal Chs7 and any human homologs would be crucial for developing selective inhibitors.

Given the differences in antifungal susceptibility between E. nidulans and related species, targeting Chs7 might provide novel therapeutic approaches for resistant infections .

How might genetic engineering of Chs7 expression be used to modify cell wall properties for research applications?

Manipulation of Chs7 expression offers potential for engineering fungal cell walls:

  • Controlled chitin content: Modulating Chs7 levels using inducible promoters could allow precise control over chitin synthesis rates.

  • Cell wall architecture studies: Creating Chs7 variants with altered specificity might redirect different chitin synthases, changing the spatial organization of chitin in the cell wall.

  • Stress response research: Engineering strains with modified Chs7 function could reveal mechanisms of cell wall remodeling during environmental stress.

  • Synthetic biology applications: Combining Chs7 engineering with modifications to other cell wall biosynthesis pathways could create fungi with novel surface properties for research purposes.

Such approaches require precise genetic tools like CRISPR-Cas9 for targeted modifications and careful phenotypic characterization using methods discussed in section 4.2.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.