Recombinant Emericella nidulans Cytochrome c oxidase assembly protein cox16, mitochondrial (cox16)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Emericella nidulans Cytochrome c oxidase assembly protein cox16, mitochondrial (Cox16) is a protein involved in the biogenesis of cytochrome c oxidase . Cytochrome c oxidase, also known as complex IV, is an enzyme located in the mitochondrial membrane that is essential for cellular respiration . Cox16 assists in the insertion of copper into Cox2, a step required for the assembly of a functional cytochrome c oxidase complex .

Synonyms

  • cox16

  • AN10871

  • Cytochrome c oxidase assembly protein cox16, mitochondrial

Gene Information

CategoryInformation
SpeciesEmericella nidulans
Gene Namecox16
Synonymscox16; AN10871; Cytochrome c oxidase assembly protein cox16, mitochondrial
UniProt IDQ5AXJ9
ORF NameAN10871
Expression RegionFull Length of Mature Protein (13-134)

Structure and Properties

Cox16 is an inner mitochondrial membrane protein . It contains a single transmembrane domain, with its C-terminus facing the intermembrane space . The full-length recombinant Emericella nidulans Cox16 protein consists of 122 amino acids (13-134) . The molecular weight of the protein is approximately 14 kDa .

The AA Sequence is: TTASSTLGEKLGEAYRARLPRHPFLLFGLPFIMVIVAGSFVLTPATALRYERYDRKVKQLSQEEAMDLGLKGPDGEEGIKRNPRRRIIGDDREEYYRLMAKDLDSWEQKRVQRFKGEPDGRL .

Function

Cox16 is required for the biogenesis of cytochrome c oxidase . Specifically, it functions in the copper insertion into Cox2 and facilitates the association of Cox2 with the MITRAC-COX1 module, which is required for the progression of cytochrome c oxidase assembly . Studies using knockout cell lines have demonstrated that the absence of Cox16 leads to a severe reduction in cytochrome c oxidase activity .

Expression and Purification

Recombinant Cox16 can be expressed in E. coli with an N-terminal His tag . The purification process typically involves affinity chromatography using the His tag, followed by removal of the tag . The purity of the recombinant protein is generally greater than 90%, as determined by SDS-PAGE .

Emericella nidulans

Emericella nidulans, also known as Aspergillus nidulans, is a filamentous fungus that belongs to the phylum Ascomycota . It is commonly found in soil and decaying plant material . Emericella nidulans is used as a model organism in genetics and molecular biology studies . It has a sexual cycle, which allows for genetic analysis of various biological processes . Emericella nidulans can cause infections in humans, particularly in immunocompromised individuals . It has been identified as a causative agent of invasive aspergillosis .

Research Applications

Recombinant Cox16 is useful in studying the structure, function, and interactions of this protein . Some research applications include:

  • Enzyme assays: Assessing the activity of cytochrome c oxidase in the presence or absence of Cox16 .

  • Protein-protein interaction studies: Identifying proteins that interact with Cox16 during cytochrome c oxidase assembly .

  • Structural studies: Determining the three-dimensional structure of Cox16 .

  • Antibody production: Generating antibodies against Cox16 for use in Western blotting and immunofluorescence assays .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
cox16; AN10871; Cytochrome c oxidase assembly protein cox16, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
13-134
Protein Length
Full Length of Mature Protein
Species
Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)
Target Names
cox16
Target Protein Sequence
TTASSTLGEKLGEAYRARLPRHPFLLFGLPFIMVIVAGSFVLTPATALRYERYDRKVKQL SQEEAMDLGLKGPDGEEGIKRNPRRRIIGDDREEYYRLMAKDLDSWEQKRVQRFKGEPDG RL
Uniprot No.

Target Background

Function
Essential for the assembly of mitochondrial respiratory chain complex IV (CIV), also known as cytochrome c oxidase. It may also play a role in the convergence of COX1 and COX2 assembly pathways.
Database Links

KEGG: ani:AN6981.2

Protein Families
COX16 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the function of COX16 in cytochrome c oxidase assembly?

COX16 is a conserved protein essential for the biogenesis of cytochrome c oxidase (Complex IV), the terminal complex of the mitochondrial respiratory chain. Research has demonstrated that COX16 specifically interacts with newly synthesized COX2 and participates in copper center formation. It functions primarily by:

  • Facilitating the interaction between SCO1 (a copper chaperone) and newly synthesized COX2 subunits

  • Participating in Cu₂⁺ insertion into the CuA sites of COX2

  • Assisting in the merging of COX1 and COX2 assembly pathways

  • Promoting the integration of fully assembled COX2 modules into COX1-containing assembly intermediates (MITRAC complexes)

COX16 deficiency leads to increased turnover of newly synthesized COX2 and accumulation of COX1 in MITRAC complexes, indicating its crucial role in coordinating the assembly of multiple respiratory complex subunits .

How is COX16 localized within mitochondria?

Based on experimental evidence from human COX16 homologs, which share structural similarities with E. nidulans COX16:

  • COX16 is an integral inner mitochondrial membrane protein

  • The protein becomes accessible to protease treatment only when the outer membrane is disrupted, confirming its localization to the inner membrane

  • It resists carbonate extraction, further supporting its status as an integral membrane protein rather than a peripheral or matrix protein

  • The C-terminus of the protein faces the intermembrane space (IMS)

Unlike its yeast counterpart, human (and likely E. nidulans) COX16 lacks a predictable N-terminal presequence that typically directs mitochondrial import, suggesting alternative mitochondrial targeting mechanisms .

What are the recommended protocols for reconstitution and storage of recombinant COX16?

For optimal handling of recombinant E. nidulans COX16 protein:

ParameterRecommendationNotes
Initial handlingBrief centrifugation prior to openingEnsures contents settle to the bottom of the vial
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mLUse freshly prepared water to avoid contamination
Storage bufferTris/PBS-based buffer, pH 8.0 with 6% TrehaloseMaintains protein stability during storage
Long-term storageAdd glycerol to 5-50% final concentration and store at -20°C/-80°C50% glycerol is commonly used as default
AliquotingMultiple small aliquots recommendedAvoids repeated freeze-thaw cycles
Freeze-thawMinimize repeated cyclesStore working aliquots at 4°C for up to one week

These parameters are critical for maintaining protein activity and structural integrity during experimental procedures .

What techniques are most effective for analyzing COX16's interactions with assembly factors?

Several complementary approaches can be used to study COX16 interactions:

  • Immunoprecipitation followed by mass spectrometry:

    • Allows identification of COX16 interaction partners in an unbiased manner

    • Can be performed with tagged versions of COX16 (His-tag or V5-tag) or with antibodies against endogenous COX16

    • Quantitative approaches like SILAC (Stable Isotope Labeling by Amino acids in Cell culture) enhance detection of specific interactions

  • Blue Native PAGE (BN-PAGE) followed by immunoblotting:

    • Enables visualization of COX16-containing protein complexes

    • Can identify co-migration with known assembly factors

    • Provides information about the size and stability of complexes

  • Two-dimensional BN-PAGE/SDS-PAGE:

    • Allows detection of specific subunits within assembly intermediates

    • Particularly useful for monitoring accumulation of specific subunits (e.g., COX1) in assembly intermediates

    • Helps determine which step of complex assembly is affected by COX16 deficiency

  • Radiolabeling of mitochondrial translation products:

    • Enables tracking of newly synthesized mitochondrial-encoded subunits

    • Can reveal specific interactions between COX16 and newly synthesized COX2

    • Useful for assessing the impact of COX16 on the stability of newly synthesized subunits

These methods can be combined to build a comprehensive picture of COX16's role in complex IV assembly.

How can researchers effectively introduce tagged versions of COX16 for functional studies?

Based on successful approaches documented in the literature:

  • Lentiviral transduction:

    • Efficient method for delivering COX16 cDNA to cell lines

    • Can be used with various tags (V5, His, GFP) for different experimental purposes

    • Allows for stable expression over multiple cell passages

  • Tag positioning considerations:

    • C-terminal tagging is generally preferred as it avoids disrupting potential N-terminal import signals

    • Both His-tags and V5-tags have been successfully used without compromising function

    • GFP-tagged versions may be useful for localization studies but should be validated for functionality

  • Expression level control:

    • Use of inducible promoters allows titration of expression levels

    • Comparison with endogenous expression levels is recommended to avoid artifacts from overexpression

    • Western blot validation of expression is essential using both tag-specific and COX16-specific antibodies

  • Functional validation:

    • Tagged versions should be tested for complementation of COX16 deficiency

    • Restoration of complex IV assembly and function confirms the tagged protein's functionality

    • BN-PAGE analysis can verify assembly of mature complex IV in complemented cells

How does the loss of COX16 affect mitochondrial respiratory chain assembly?

COX16 deficiency has profound effects on respiratory chain assembly, particularly complex IV:

  • Impact on COX2 processing and stability:

    • Decreased association of SCO1 with newly synthesized COX2

    • Impaired copper insertion into the CuA site of COX2

    • Increased turnover of COX2, likely due to improper copper center formation

  • Accumulation of assembly intermediates:

    • Buildup of COX1 in MITRAC assembly intermediates

    • Reduced incorporation of COX2 into mature complex IV

    • Quantifiable reduction in fully assembled complex IV detected by BN-PAGE

  • Functional consequences:

    • Reduced cytochrome c oxidase activity

    • Impaired respiratory capacity

    • Potential compensatory changes in other respiratory complexes

The comparative analysis of assembly intermediate accumulation in wild-type versus COX16-deficient cells reveals that COX16 is particularly crucial for the later stages of complex IV assembly, specifically the incorporation of copper-loaded COX2 into the enzyme complex .

What methodological considerations are important for complementation studies using COX16?

When designing complementation experiments to validate COX16 function:

  • Experimental design considerations:

    • Include appropriate controls (empty vector, GFP-only) alongside wild-type COX16 complementation

    • Consider testing different expression levels to avoid artifacts

    • Include both tagged and untagged versions to assess potential tag interference

  • Functional readouts to assess complementation efficacy:

    • BN-PAGE/immunoblotting to quantify complex IV assembly restoration

    • SDS-PAGE/Western blot to measure stabilization of complex IV subunits

    • Enzyme activity assays to confirm functional restoration of cytochrome c oxidase

    • 2D-BN-PAGE/SDS-PAGE to assess normalization of assembly intermediate profiles

  • Time course considerations:

    • Allow sufficient time after complementation for assembly of new complexes

    • Consider pulse-chase experiments to track the incorporation of newly synthesized subunits

    • Monitor stability of complementation over multiple cell passages

In published studies, successful complementation has been demonstrated by the increased levels of fully assembled complex IV in BN-PAGE analysis and increased steady-state levels of complex IV subunits (particularly COX1, COX2, and to a lesser extent COX4 and COX5A) in cells complemented with wild-type COX16 compared to control-transduced cells .

What techniques can be used to study the specific role of COX16 in copper insertion into COX2?

Investigating the specific role of COX16 in copper metallation of COX2 requires specialized approaches:

  • Protein-protein interaction studies:

    • Co-immunoprecipitation of COX16 with copper chaperones (SCO1, SCO2, COA6)

    • Analysis of the impact of patient-mimicking mutations in copper chaperones on their interaction with COX16

    • Assessment of COX16 requirement for recruitment of SCO1 to newly synthesized COX2

  • Copper incorporation assays:

    • Radioactive copper (⁶⁴Cu) incorporation studies to measure copper loading

    • Spectroscopic analysis of copper centers in purified complex IV

    • Comparison of copper incorporation in wild-type versus COX16-deficient cells

  • Structural analysis approaches:

    • Identification of potential copper-binding motifs in COX16

    • Mutational analysis of conserved residues potentially involved in copper handling

    • Comparative analysis with other proteins involved in copper metabolism

These methodologies can help elucidate whether COX16 serves primarily as a scaffold that brings together copper chaperones and COX2, or if it plays a more direct role in copper transfer and incorporation .

How conserved is COX16 function across different species?

Studies have revealed both conservation and divergence in COX16 function across species:

SpeciesSimilaritiesDifferencesReference
HumanInner membrane protein, essential for complex IV assemblyDoes not associate with mature complex IV, primarily associates with COX2 assembly modules
S. cerevisiaeInner membrane protein, required for cytochrome c oxidase assemblyPresent in mature complex IV and supercomplexes, has a predictable N-terminal presequence
E. nidulansInner membrane protein, role in complex IV assemblyLimited functional characterization, structural similarities to human COX16

Key observations across species:

  • The basic role in cytochrome c oxidase assembly is conserved

  • Human COX16 does not complement yeast Cox16 deficiency, indicating functional divergence

  • Association with assembly intermediates versus mature complexes differs between species

  • Structural features like targeting sequences show evolutionary divergence

These differences highlight the importance of species-specific studies rather than direct extrapolation between model organisms .

What experimental systems are most appropriate for studying E. nidulans COX16 function?

Several experimental approaches can be considered for studying E. nidulans COX16:

  • Homologous expression systems:

    • E. nidulans itself as a host organism, particularly for in vivo functional studies

    • Gene knockout and complementation in E. nidulans using established genetic tools

    • Advantages include native cellular environment and post-translational modifications

  • Heterologous expression systems:

    • E. coli for recombinant protein production, as demonstrated with His-tagged versions

    • Mammalian cells for functional complementation studies

    • Yeast models for comparative functional analysis

  • Comparative approaches:

    • Side-by-side analysis with human and yeast homologs

    • Chimeric proteins to identify functionally important domains

    • Cross-species complementation to assess functional conservation

When using E. coli as an expression system for recombinant E. nidulans COX16, researchers should be aware that while protein production is efficient, the bacterial system lacks the mitochondrial environment and may not support all post-translational modifications or proper membrane insertion .

What are common challenges in working with recombinant COX16 and how can they be addressed?

Researchers working with recombinant COX16 often encounter several technical challenges:

  • Protein solubility issues:

    • Challenge: As a membrane protein, COX16 can aggregate during purification

    • Solution: Use appropriate detergents (e.g., mild non-ionic detergents like Digitonin or DDM)

    • Consider purification under native conditions to maintain structural integrity

  • Proper folding verification:

    • Challenge: Ensuring the recombinant protein adopts native conformation

    • Solution: Functional complementation assays in knockout models

    • Structural analysis techniques like circular dichroism or limited proteolysis

  • Storage stability:

    • Challenge: Activity loss during storage

    • Solution: Addition of 5-50% glycerol and storage at -80°C

    • Aliquoting to avoid repeated freeze-thaw cycles

    • Working aliquots can be maintained at 4°C for up to one week

  • Expression yield optimization:

    • Challenge: Low expression levels

    • Solution: Codon optimization for the expression host

    • Optimization of induction conditions (temperature, inducer concentration, duration)

    • Consider using fusion partners to enhance solubility and expression

Regular quality control testing using SDS-PAGE to verify protein integrity is recommended before experimental use .

How can researchers verify the functional integrity of purified recombinant COX16?

Ensuring that purified recombinant COX16 retains its native functional properties is critical:

  • Structural verification:

    • SDS-PAGE analysis to confirm expected molecular weight and purity (>90% is typically acceptable)

    • Western blotting with antibodies against both the tag and COX16 itself

    • Mass spectrometry to verify sequence coverage and post-translational modifications

  • Functional validation approaches:

    • In vitro binding assays with known interaction partners (e.g., SCO1, COX2)

    • Complementation studies in COX16-deficient cell lines

    • BN-PAGE analysis to verify incorporation into expected protein complexes

  • Activity correlations:

    • Correlation between protein concentration and functional readouts

    • Comparison with native COX16 isolated from mitochondria

    • Dose-dependent effects in complementation assays

These validation steps help ensure that experimental observations truly reflect the biological properties of COX16 rather than artifacts of the recombinant protein production process .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.