Recombinant Emericella nidulans Cytochrome c oxidase assembly protein cox16, mitochondrial (Cox16) is a protein involved in the biogenesis of cytochrome c oxidase . Cytochrome c oxidase, also known as complex IV, is an enzyme located in the mitochondrial membrane that is essential for cellular respiration . Cox16 assists in the insertion of copper into Cox2, a step required for the assembly of a functional cytochrome c oxidase complex .
Cox16 is an inner mitochondrial membrane protein . It contains a single transmembrane domain, with its C-terminus facing the intermembrane space . The full-length recombinant Emericella nidulans Cox16 protein consists of 122 amino acids (13-134) . The molecular weight of the protein is approximately 14 kDa .
The AA Sequence is: TTASSTLGEKLGEAYRARLPRHPFLLFGLPFIMVIVAGSFVLTPATALRYERYDRKVKQLSQEEAMDLGLKGPDGEEGIKRNPRRRIIGDDREEYYRLMAKDLDSWEQKRVQRFKGEPDGRL .
Cox16 is required for the biogenesis of cytochrome c oxidase . Specifically, it functions in the copper insertion into Cox2 and facilitates the association of Cox2 with the MITRAC-COX1 module, which is required for the progression of cytochrome c oxidase assembly . Studies using knockout cell lines have demonstrated that the absence of Cox16 leads to a severe reduction in cytochrome c oxidase activity .
Recombinant Cox16 can be expressed in E. coli with an N-terminal His tag . The purification process typically involves affinity chromatography using the His tag, followed by removal of the tag . The purity of the recombinant protein is generally greater than 90%, as determined by SDS-PAGE .
Emericella nidulans, also known as Aspergillus nidulans, is a filamentous fungus that belongs to the phylum Ascomycota . It is commonly found in soil and decaying plant material . Emericella nidulans is used as a model organism in genetics and molecular biology studies . It has a sexual cycle, which allows for genetic analysis of various biological processes . Emericella nidulans can cause infections in humans, particularly in immunocompromised individuals . It has been identified as a causative agent of invasive aspergillosis .
Recombinant Cox16 is useful in studying the structure, function, and interactions of this protein . Some research applications include:
Enzyme assays: Assessing the activity of cytochrome c oxidase in the presence or absence of Cox16 .
Protein-protein interaction studies: Identifying proteins that interact with Cox16 during cytochrome c oxidase assembly .
Structural studies: Determining the three-dimensional structure of Cox16 .
Antibody production: Generating antibodies against Cox16 for use in Western blotting and immunofluorescence assays .
KEGG: ani:AN6981.2
COX16 is a conserved protein essential for the biogenesis of cytochrome c oxidase (Complex IV), the terminal complex of the mitochondrial respiratory chain. Research has demonstrated that COX16 specifically interacts with newly synthesized COX2 and participates in copper center formation. It functions primarily by:
Facilitating the interaction between SCO1 (a copper chaperone) and newly synthesized COX2 subunits
Promoting the integration of fully assembled COX2 modules into COX1-containing assembly intermediates (MITRAC complexes)
COX16 deficiency leads to increased turnover of newly synthesized COX2 and accumulation of COX1 in MITRAC complexes, indicating its crucial role in coordinating the assembly of multiple respiratory complex subunits .
Based on experimental evidence from human COX16 homologs, which share structural similarities with E. nidulans COX16:
The protein becomes accessible to protease treatment only when the outer membrane is disrupted, confirming its localization to the inner membrane
It resists carbonate extraction, further supporting its status as an integral membrane protein rather than a peripheral or matrix protein
The C-terminus of the protein faces the intermembrane space (IMS)
Unlike its yeast counterpart, human (and likely E. nidulans) COX16 lacks a predictable N-terminal presequence that typically directs mitochondrial import, suggesting alternative mitochondrial targeting mechanisms .
For optimal handling of recombinant E. nidulans COX16 protein:
| Parameter | Recommendation | Notes |
|---|---|---|
| Initial handling | Brief centrifugation prior to opening | Ensures contents settle to the bottom of the vial |
| Reconstitution | Deionized sterile water to 0.1-1.0 mg/mL | Use freshly prepared water to avoid contamination |
| Storage buffer | Tris/PBS-based buffer, pH 8.0 with 6% Trehalose | Maintains protein stability during storage |
| Long-term storage | Add glycerol to 5-50% final concentration and store at -20°C/-80°C | 50% glycerol is commonly used as default |
| Aliquoting | Multiple small aliquots recommended | Avoids repeated freeze-thaw cycles |
| Freeze-thaw | Minimize repeated cycles | Store working aliquots at 4°C for up to one week |
These parameters are critical for maintaining protein activity and structural integrity during experimental procedures .
Several complementary approaches can be used to study COX16 interactions:
Immunoprecipitation followed by mass spectrometry:
Allows identification of COX16 interaction partners in an unbiased manner
Can be performed with tagged versions of COX16 (His-tag or V5-tag) or with antibodies against endogenous COX16
Quantitative approaches like SILAC (Stable Isotope Labeling by Amino acids in Cell culture) enhance detection of specific interactions
Blue Native PAGE (BN-PAGE) followed by immunoblotting:
Two-dimensional BN-PAGE/SDS-PAGE:
Radiolabeling of mitochondrial translation products:
These methods can be combined to build a comprehensive picture of COX16's role in complex IV assembly.
Based on successful approaches documented in the literature:
Lentiviral transduction:
Tag positioning considerations:
Expression level control:
Functional validation:
COX16 deficiency has profound effects on respiratory chain assembly, particularly complex IV:
Impact on COX2 processing and stability:
Accumulation of assembly intermediates:
Functional consequences:
Reduced cytochrome c oxidase activity
Impaired respiratory capacity
Potential compensatory changes in other respiratory complexes
The comparative analysis of assembly intermediate accumulation in wild-type versus COX16-deficient cells reveals that COX16 is particularly crucial for the later stages of complex IV assembly, specifically the incorporation of copper-loaded COX2 into the enzyme complex .
When designing complementation experiments to validate COX16 function:
Experimental design considerations:
Functional readouts to assess complementation efficacy:
Time course considerations:
Allow sufficient time after complementation for assembly of new complexes
Consider pulse-chase experiments to track the incorporation of newly synthesized subunits
Monitor stability of complementation over multiple cell passages
In published studies, successful complementation has been demonstrated by the increased levels of fully assembled complex IV in BN-PAGE analysis and increased steady-state levels of complex IV subunits (particularly COX1, COX2, and to a lesser extent COX4 and COX5A) in cells complemented with wild-type COX16 compared to control-transduced cells .
Investigating the specific role of COX16 in copper metallation of COX2 requires specialized approaches:
Protein-protein interaction studies:
Copper incorporation assays:
Radioactive copper (⁶⁴Cu) incorporation studies to measure copper loading
Spectroscopic analysis of copper centers in purified complex IV
Comparison of copper incorporation in wild-type versus COX16-deficient cells
Structural analysis approaches:
Identification of potential copper-binding motifs in COX16
Mutational analysis of conserved residues potentially involved in copper handling
Comparative analysis with other proteins involved in copper metabolism
These methodologies can help elucidate whether COX16 serves primarily as a scaffold that brings together copper chaperones and COX2, or if it plays a more direct role in copper transfer and incorporation .
Studies have revealed both conservation and divergence in COX16 function across species:
Key observations across species:
The basic role in cytochrome c oxidase assembly is conserved
Human COX16 does not complement yeast Cox16 deficiency, indicating functional divergence
Association with assembly intermediates versus mature complexes differs between species
Structural features like targeting sequences show evolutionary divergence
These differences highlight the importance of species-specific studies rather than direct extrapolation between model organisms .
Several experimental approaches can be considered for studying E. nidulans COX16:
Homologous expression systems:
Heterologous expression systems:
Comparative approaches:
Side-by-side analysis with human and yeast homologs
Chimeric proteins to identify functionally important domains
Cross-species complementation to assess functional conservation
When using E. coli as an expression system for recombinant E. nidulans COX16, researchers should be aware that while protein production is efficient, the bacterial system lacks the mitochondrial environment and may not support all post-translational modifications or proper membrane insertion .
Researchers working with recombinant COX16 often encounter several technical challenges:
Protein solubility issues:
Proper folding verification:
Challenge: Ensuring the recombinant protein adopts native conformation
Solution: Functional complementation assays in knockout models
Structural analysis techniques like circular dichroism or limited proteolysis
Storage stability:
Expression yield optimization:
Challenge: Low expression levels
Solution: Codon optimization for the expression host
Optimization of induction conditions (temperature, inducer concentration, duration)
Consider using fusion partners to enhance solubility and expression
Regular quality control testing using SDS-PAGE to verify protein integrity is recommended before experimental use .
Ensuring that purified recombinant COX16 retains its native functional properties is critical:
Structural verification:
Functional validation approaches:
In vitro binding assays with known interaction partners (e.g., SCO1, COX2)
Complementation studies in COX16-deficient cell lines
BN-PAGE analysis to verify incorporation into expected protein complexes
Activity correlations:
Correlation between protein concentration and functional readouts
Comparison with native COX16 isolated from mitochondria
Dose-dependent effects in complementation assays
These validation steps help ensure that experimental observations truly reflect the biological properties of COX16 rather than artifacts of the recombinant protein production process .