Recombinant Emericella nidulans Cytochrome c oxidase subunit 2 (cox2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. To prioritize a specific tag, please indicate your requirements.
Synonyms
cox2; oxiB; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-252
Protein Length
full length protein
Species
Emericella nidulans (Aspergillus nidulans)
Target Names
cox2
Target Protein Sequence
MFLIMLKGHILMDAPTPWGIFFQDSASPQMEGIMELHNNIMFYLAIILFTVTWMMITIIR NFVAKKSPIAHKYMNHGTLIELIWTITPAFILILIAFPSFKLLYLMDEVMDPSLVVYAEG HQWYWSYQYPDFTNEDNEFIEFDSYIVPESDLEEGQFRMLEVDNRVIIPELTHTAFVISA DVIHSYACPSLGIKADAYPGRLNQASVYINGPGTFFGQCSEICGILHSSMNIAIQSVSIK DFLLWLRDQMEG
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (COX2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes cooperatively transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. COX2 specifically catalyzes the reduction of oxygen to water within Complex IV. Electrons from reduced cytochrome c in the intermembrane space are transferred via the copper A center (CuA) and heme A to the binuclear center (BNC) in subunit 1, consisting of heme A3 and copper B (CuB). The BNC utilizes these four electrons from cytochrome c and four protons from the mitochondrial matrix to reduce molecular oxygen to two water molecules.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How does recombinant E. nidulans Cox2 differ from the native protein?

Recombinant E. nidulans Cox2 protein typically includes modifications that facilitate purification and detection while attempting to maintain native functionality:

FeatureNative Cox2Recombinant Cox2
Expression systemMitochondria of E. nidulansHeterologous (typically E. coli)
Post-translational modificationsComplete mitochondrial-specific modificationsLimited or absent
N-terminal sequenceNative mitochondrial targeting sequenceOften includes His-tag or other fusion tags
SolubilityIntegrated in membraneOften requires detergents or solubilizing agents
Copper incorporationCompleteVariable, may require reconstitution

The recombinant form includes an N-terminal His-tag to facilitate purification through affinity chromatography, which is not present in the native form . Researchers should consider these differences when designing experiments, particularly those investigating protein-protein interactions or enzymatic activity.

What are the recommended storage conditions for recombinant E. nidulans Cox2?

For optimal stability and activity retention of recombinant E. nidulans Cox2:

  • Store lyophilized protein at -20°C to -80°C upon receipt

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 30-50% for long-term storage

  • Aliquot to avoid repeated freeze-thaw cycles, which significantly reduce protein activity

  • For working stocks, store at 4°C for up to one week to minimize degradation

For experiments requiring precise activity measurements, prepare fresh aliquots rather than using protein that has undergone multiple freeze-thaw cycles, as this can affect structural integrity and functional properties of membrane proteins like Cox2.

What expression systems are most effective for producing functional recombinant E. nidulans Cox2?

While E. coli is commonly used for initial expression of recombinant E. nidulans Cox2 , several expression systems offer advantages for different research applications:

Expression SystemAdvantagesLimitationsBest For
E. coliHigh yield, simple protocols, cost-effectiveLimited post-translational modifications, inclusion body formationStructural studies, antibody production
Yeast (S. cerevisiae)More native-like processing, better foldingLower yields than E. coliFunctional studies requiring proper folding
Filamentous fungiMost native-like environmentComplex protocols, time-consumingStudies of protein-protein interactions
Cell-free systemsRapid expression, direct incorporation of modified amino acidsExpensive, limited scaleMechanistic studies with labeled proteins

For producing functional enzyme, researchers often employ a dual approach: initial high-yield expression in E. coli followed by in vitro reconstitution of copper centers using controlled redox conditions. This methodology mirrors techniques used with other cytochrome c oxidase subunits from phylogenetically related species .

How can I optimize PCR amplification of the E. nidulans cox2 gene for subsequent cloning?

Optimizing PCR amplification of the E. nidulans cox2 gene requires consideration of several factors:

  • Primer design:

    • Include appropriate restriction sites for subsequent cloning

    • Design primers with melting temperatures between 55-65°C

    • For the forward primer, use sequence corresponding to the 5' region: 5'-ATGTTCCTCATCATGCTCAAGGGC-3'

    • For the reverse primer, use sequence corresponding to the 3' region: 5'-TTACATCTCCATCAATGCAAGTCG-3'

  • PCR reaction conditions:

    • Initial denaturation: 94°C for 5 minutes

    • 30-35 cycles of:

      • Denaturation: 94°C for 30 seconds

      • Annealing: 55-58°C for 30 seconds (requires optimization)

      • Extension: 72°C for 1 minute (approximately 1 minute per kb)

    • Final extension: 72°C for 10 minutes

  • Reaction mixture components:

    • High-fidelity DNA polymerase to minimize mutations

    • 1.5-2.5 mM MgCl₂ (concentration requires optimization)

    • DMSO (5-10%) may improve amplification of GC-rich regions

This approach draws on methodologies similar to those used for amplifying COX2 genes from other fungal species, with modifications specific to the E. nidulans sequence characteristics .

What purification strategy yields the highest purity of functionally active recombinant E. nidulans Cox2?

A multi-step purification strategy is recommended for obtaining high-purity, functionally active recombinant E. nidulans Cox2:

  • Initial capture using immobilized metal affinity chromatography (IMAC):

    • Equilibrate Ni-NTA column with buffer containing 20 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole

    • Apply clarified lysate containing His-tagged Cox2

    • Wash with increasing imidazole concentrations (20-50 mM)

    • Elute with buffer containing 250-300 mM imidazole

  • Intermediate purification via ion exchange chromatography:

    • Dialyze IMAC-purified protein against low-salt buffer (20 mM Tris-HCl pH 8.0, 50 mM NaCl)

    • Apply to anion exchange column (e.g., Q-Sepharose)

    • Elute with linear salt gradient (50-500 mM NaCl)

  • Polishing step using size exclusion chromatography:

    • Apply concentrated protein to Superdex 75/200 column

    • Elute with buffer containing 20 mM Tris-HCl pH 8.0, 150 mM NaCl

  • Detergent considerations:

    • Include mild detergents (0.05-0.1% DDM or LDAO) in all buffers to maintain solubility

    • For functional studies, reconstitute in lipid nanodisc or liposome systems

This purification strategy typically yields protein with >90% purity suitable for structural and functional studies .

How can I assess the copper incorporation and redox activity of recombinant E. nidulans Cox2?

Copper incorporation and redox activity assessment of recombinant E. nidulans Cox2 involves multiple complementary techniques:

  • Spectroscopic analysis:

    • UV-visible spectroscopy to monitor characteristic absorption peaks at approximately 420 nm and 550-600 nm

    • Electron paramagnetic resonance (EPR) spectroscopy to detect Cu²⁺ centers

    • X-ray absorption spectroscopy for detailed copper coordination environment

  • Quantitative copper analysis:

    • Atomic absorption spectroscopy (AAS) to determine copper:protein ratio

    • Inductively coupled plasma mass spectrometry (ICP-MS) for precise metal quantification

    • Colorimetric assays using bathocuproine disulfonate (BCS) or bicinchoninic acid (BCA)

  • Functional redox assays:

    • Oxygen consumption measurements using Clark-type oxygen electrodes

    • Cytochrome c oxidation rates monitoring absorbance decrease at 550 nm

    • Membrane potential measurements using potential-sensitive dyes

Expected values for properly folded E. nidulans Cox2 include a copper:protein ratio approaching 2:1 and cytochrome c oxidation rates comparable to those of native mitochondrial preparations when assembled with other cytochrome oxidase subunits.

What methods are effective for analyzing protein-protein interactions involving recombinant E. nidulans Cox2?

Multiple complementary approaches can effectively analyze protein-protein interactions involving recombinant E. nidulans Cox2:

  • Co-immunoprecipitation (Co-IP):

    • Use anti-His antibodies to precipitate recombinant Cox2

    • Identify interacting partners via mass spectrometry

    • Confirm specific interactions with western blotting

  • Surface plasmon resonance (SPR):

    • Immobilize recombinant Cox2 on sensor chip via His-tag

    • Measure binding kinetics with putative interacting proteins

    • Determine association/dissociation constants (ka, kd, KD)

  • Crosslinking mass spectrometry (XL-MS):

    • Treat protein complexes with crosslinkers like BS3 or DSS

    • Digest crosslinked samples and analyze by LC-MS/MS

    • Identify interaction interfaces from crosslinked peptides

  • Blue native PAGE:

    • Analyze intact protein complexes under native conditions

    • Identify complex composition via second-dimension SDS-PAGE

    • Compare complex formation with native mitochondrial complexes

  • Proximity-based labeling:

    • Express Cox2 fused to enzymes like BioID or APEX2

    • Allow in vivo labeling of proximal proteins

    • Identify interaction network via streptavidin pulldown and MS

These methods have been successfully applied to study Cox2 interactions in related fungal species and can be adapted for specific research questions involving E. nidulans Cox2 .

How can recombinant E. nidulans Cox2 be used to study evolutionary patterns in fungal respiratory chains?

Recombinant E. nidulans Cox2 provides a valuable tool for comparative evolutionary studies of fungal respiratory chains:

  • Sequence-based evolutionary analysis:

    • Align Cox2 sequences from diverse fungal lineages

    • Calculate evolutionary rates using models like Kimura-2-parameter

    • Construct phylogenetic trees to visualize evolutionary relationships

  • Structure-function comparative studies:

    • Express recombinant Cox2 from multiple fungal species

    • Compare biochemical properties and activities

    • Identify conserved versus variable functional elements

  • Hybrid complex assembly:

    • Create chimeric Cox2 proteins with domains from different species

    • Assess functional compatibility in reconstituted complexes

    • Identify co-evolutionary constraints within respiratory complexes

Based on studies with related fungal Cox2 proteins, the evolutionary rate for Cox2 is estimated at approximately 11.4% sequence divergence per 108 years, making it a valuable marker for studying both recent and ancient evolutionary events in fungi .

What are the key considerations when designing site-directed mutagenesis experiments with E. nidulans Cox2?

When designing site-directed mutagenesis experiments with E. nidulans Cox2, consider:

  • Target selection strategy:

    • Conserved residues identified through multiple sequence alignments

    • Known functional residues from homologous proteins

    • Copper-binding sites (H193, C196, H197, C200) critical for electron transfer

    • Transmembrane residues involved in proton channels

    • Interface residues for interaction with other subunits

  • Mutation design considerations:

    • Conservative substitutions to probe specific chemical properties

    • Radical substitutions to test functional requirements

    • Alanine scanning for systematic functional mapping

    • Introduction/removal of potential post-translational modification sites

  • Expression and characterization challenges:

    • Some mutations may affect protein stability and expression

    • Copper incorporation may be compromised

    • Assembly with other subunits may be affected

    • Functional assays may require reconstitution strategies

  • Control experiments:

    • Include wild-type protein controls processed identically

    • Consider creating revertant mutations to confirm specificity

    • Test multiple similar mutations to establish structure-function relationships

These approaches have been successfully applied to cytochrome c oxidase subunits from related fungal species to elucidate mechanism and evolutionary patterns .

How can transcriptomics and proteomics approaches be integrated with recombinant E. nidulans Cox2 studies?

Integration of transcriptomics and proteomics with recombinant E. nidulans Cox2 studies enables comprehensive understanding of respiratory chain biology:

  • Transcriptomic applications:

    • RNA-seq to identify co-regulated genes under different growth conditions

    • Analysis of nuclear vs. mitochondrial gene expression coordination

    • Identification of potential regulatory mechanisms affecting Cox2 expression

    • Comparative transcriptomics across fungal species to identify conserved expression patterns

  • Proteomic approaches:

    • Quantitative proteomics to measure stoichiometry of respiratory complex components

    • Post-translational modification mapping using mass spectrometry

    • Protein turnover analysis using pulse-chase experiments with labeled amino acids

    • Interaction proteomics using Cox2 as bait in different cellular conditions

  • Integration strategies:

    • Correlation analysis between transcript and protein levels

    • Network analysis to identify functional modules and regulatory hubs

    • Systematic perturbation studies (knockdowns, inhibitors) paired with -omics

    • Machine learning approaches to predict regulatory relationships

  • Experimental design example:

    • Express tagged recombinant Cox2 in E. nidulans

    • Compare respiratory growth in wild-type vs. modified strains

    • Perform parallel RNA-seq and proteomics under different growth conditions

    • Integrate datasets to identify condition-specific regulation patterns

This integrated approach has revealed sophisticated regulatory networks governing mitochondrial function in other fungal systems and can be applied to E. nidulans .

What strategies can resolve solubility and stability issues with recombinant E. nidulans Cox2?

Solubility and stability challenges with recombinant E. nidulans Cox2 can be addressed through multiple strategies:

  • Expression optimization:

    • Lower induction temperature (16-20°C)

    • Reduce inducer concentration

    • Co-express with chaperones (GroEL/GroES, DnaK/DnaJ)

    • Use solubility-enhancing fusion partners (MBP, SUMO, TrxA)

  • Buffer optimization for stability:

    • Screen detergent types and concentrations (DDM, LDAO, Fos-choline)

    • Add glycerol (10-20%) to prevent aggregation

    • Include reducing agents (DTT, TCEP) at 1-5 mM

    • Test pH ranges (typically pH 7.0-8.5)

    • Add stabilizers like trehalose (6%) or sucrose (5-10%)

  • Refolding strategies if expressed in inclusion bodies:

    • Solubilize in 8M urea or 6M guanidine-HCl

    • Gradual dialysis to remove denaturant

    • On-column refolding during affinity purification

    • Pulse refolding with cyclodextrin to capture detergent

  • Reconstitution approaches:

    • Liposome incorporation using detergent removal methods

    • Nanodisc reconstitution with MSP proteins

    • Amphipol stabilization for structural studies

The lyophilized form with trehalose (6%) provides enhanced stability during storage, but requires careful reconstitution protocols to maintain functional integrity .

How can I troubleshoot issues with copper incorporation in recombinant E. nidulans Cox2?

Troubleshooting copper incorporation issues in recombinant E. nidulans Cox2 requires systematic analysis:

  • Diagnostic tests to identify the problem:

    • Atomic absorption spectroscopy to quantify copper content

    • UV-visible spectroscopy to examine characteristic absorption peaks

    • Activity assays to correlate copper content with function

    • SDS-PAGE under non-reducing conditions to check disulfide formation

  • Common issues and solutions:

    IssuePotential CausesSolutions
    Low copper incorporationReducing environment during purificationInclude Cu²⁺ in buffers, avoid strong reducing agents
    Copper binding sites not properly formedOptimize refolding conditions, adjust pH during refolding
    Competition from buffer componentsAvoid EDTA, phosphate, imidazole during copper incorporation
    Incorrect copper oxidation stateReducing environmentControl redox potential with glutathione ratios
    Spontaneous oxidation/reductionWork under anaerobic conditions when necessary
    Heterogeneous copper incorporationIncomplete foldingImprove protein quality through additional purification steps
    Partial denaturationOptimize buffer conditions to enhance stability
  • In vitro copper incorporation protocol:

    • Incubate purified apo-protein with 2-5 molar excess CuSO₄

    • Control redox environment with glutathione (GSH:GSSG ratios)

    • Remove excess copper with dialysis against chelex-treated buffer

    • Verify incorporation spectroscopically and by activity assays

This approach is based on successful copper incorporation strategies used with other fungal cytochrome oxidase subunits .

How does E. nidulans Cox2 differ from Cox2 proteins in other fungal species, and what are the functional implications?

Comparative analysis of E. nidulans Cox2 with other fungal Cox2 proteins reveals significant diversity with functional implications:

SpeciesKey Differences from E. nidulans Cox2Functional Implications
Candida glabrataFrameshift mutation at position 673 Requires frameshift suppression mechanisms for functionality
Higher sequence variability (13 haplotypes identified) Potential adaptation to diverse environments
Saccharomyces cerevisiaeNo frameshift mutations More direct translation to functional protein
Differences in copper-binding regionMay affect electron transfer kinetics
Schizosaccharomyces pombeDivergent N-terminal sequenceDifferent membrane interaction properties
Alternative splicing reportedPotential for regulatory flexibility

E. nidulans Cox2 exhibits intermediate evolutionary characteristics between the Saccharomycetales and more distant fungal lineages, with implications for:

  • Respiratory adaptation to different ecological niches

  • Evolutionary rates of mitochondrial versus nuclear genomes

  • Co-evolution with interacting proteins in the respiratory chain

  • Mechanisms of nuclear-mitochondrial genomic communication

Molecular clock analyses suggest that the evolutionary rate of fungal Cox2 (approximately 11.4% sequence divergence per 10⁸ years) makes it valuable for phylogenetic studies and for investigating relatively recent evolutionary events .

What insights can recombinant E. nidulans Cox2 provide about mitochondrial disease mechanisms?

Recombinant E. nidulans Cox2 can provide valuable insights into mitochondrial disease mechanisms through several research approaches:

  • Model system for pathogenic mutations:

    • Human mitochondrial diseases often involve cytochrome c oxidase deficiency

    • Conserved residues in fungal Cox2 can model human mutations

    • Functional consequences can be studied in a simplified system

    • Structure-function relationships can be established more easily

  • Investigation of assembly mechanisms:

    • Cox2 assembly factors are often implicated in human diseases

    • Recombinant E. nidulans Cox2 can test assembly factor requirements

    • Bottlenecks in assembly can be identified and characterized

    • Potential rescue strategies can be evaluated

  • Drug screening applications:

    • Compounds affecting Cox2 function can be rapidly screened

    • Specificity of inhibitors/activators can be assessed

    • Structure-activity relationships can be established

    • Potential therapeutic strategies can be developed

  • Oxidative stress and ROS production:

    • Cytochrome c oxidase dysfunction is linked to ROS production

    • Mutant forms of recombinant E. nidulans Cox2 can be tested for ROS generation

    • Antioxidant interventions can be evaluated

    • ROS signaling pathways can be investigated

These approaches leverage the experimental advantages of a fungal system while maintaining relevance to human mitochondrial biology through evolutionary conservation of core respiratory mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.