Recombinant Emericella nidulans Cytochrome c oxidase subunit 3 (cox3)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant Cox3 is synthesized in E. coli and purified to near-homogeneity. Critical parameters include:

ParameterSpecs
FormLyophilized powder
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL), with optional glycerol (5–50%)
Stability-20°C/-80°C (long-term), 4°C (short-term working aliquots)

Repeated freeze-thaw cycles are discouraged to preserve structural integrity .

Research Context and Future Directions

E. nidulans is a model organism for studying fungal genetics and heterologous protein production. Key insights from related studies:

  • Recombinant Protein Expression:
    A. nidulans strains engineered to produce heterologous enzymes (e.g., glycoside hydrolases) exhibit robust secretion capabilities, suggesting potential for optimizing Cox3 yield .

  • Mitochondrial Pathways:
    Functional genomics in E. nidulans has elucidated polyketide and nonribosomal peptide biosynthesis, underscoring the species’ capacity for complex biochemical pathways .

Future work could leverage E. nidulans’ genetic tractability to engineer Cox3 variants with enhanced stability or catalytic efficiency.

Table 2: Cox3 Amino Acid Sequence (Partial)

RegionSequence
N-terminalMIYQSKRNFQNHPFHLVSPSPWPLFTSISLFILTTATVLFMHGFEGFQYLVPVAVINVMY
C-terminal...FTFFQGVEYTVSSFTISDSVYGSCFYFGTGFHGLHVIIGTAFLAVGLWRLAAYHLTDHHH

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cox3; oxiC; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Emericella nidulans (Aspergillus nidulans)
Target Names
cox3
Target Protein Sequence
MIYQSKRNFQNHPFHLVSPSPWPLFTSISLFILTTATVLFMHGFEGFQYLVPVAVINVMY VMGLWFRDVISEGTYLGNHTNAVQKGLNLGVGLFIISEVFFFLAIFWAFFHSAISPSVEL GAQWPPLGIQGINPFELPLLNTIILLSSGVTITYAHHSLIQGNRKGALYGTVVTILLAIV FTFFQGVEYTVSSFTISDSVYGSCFYFGTGFHGLHVIIGTAFLAVGLWRLAAYHLTDHHH LGYESGILYWHFVDVVWLFLYISVYYWGY
Uniprot No.

Target Background

Function
Recombinant Emericella nidulans Cytochrome c oxidase subunit 3 (COX3) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain. This chain, comprising three multi-subunit complexes (Succinate Dehydrogenase – Complex II, Ubiquinol-Cytochrome c Oxidoreductase – Complex III, and Cytochrome c Oxidase – Complex IV), facilitates electron transfer from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, driving ATP synthesis. COX3 plays a crucial role in the catalytic reduction of oxygen to water within Complex IV. Electrons from reduced cytochrome c (in the intermembrane space) are transferred via the CuA center (subunit 2) and heme A (subunit 1) to the binuclear center (BNC) in subunit 1, comprising heme A3 and CuB. The BNC then reduces molecular oxygen to water using four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the significance of studying cytochrome c oxidase subunit 3 in Emericella nidulans?

Cytochrome c oxidase serves as a terminal enzyme in the respiratory electron transport chain, playing a crucial role in cellular respiration. Studying cox3 in E. nidulans is particularly valuable because this organism has a well-characterized sexual cycle and genetics system, making it an excellent model for investigating fungal respiration mechanisms . The functional characterization of cox3 in this organism can provide insights into energy metabolism, adaptation to varied oxygen conditions, and evolutionary aspects of respiratory chains across fungal species. Additionally, understanding respiratory components in pathogenic fungi like Aspergillus species may reveal potential antifungal targets, as respiratory function is essential for fungal growth and virulence.

How does cytochrome c oxidase subunit structure in E. nidulans compare to that in other organisms?

Based on studies of cytochrome c oxidase in other organisms like Rhodobacter sphaeroides, we know that these complexes typically consist of multiple subunits forming a functional enzyme. In R. sphaeroides, the cbb3-type cytochrome c oxidase consists of four nonidentical subunits (CcoN, CcoO, CcoP, and CcoQ), with the first three forming the catalytic "core" complex required for oxygen reduction and cytochrome c oxidation .

In E. nidulans, while the exact subunit composition may differ, the general principle of a multi-subunit complex is likely conserved. Comparative analysis would suggest that cox3 in E. nidulans serves as part of the core complex involved in the enzyme's catalytic activity. The uniqueness of fungal cytochrome c oxidases may lie in specific adaptations that allow survival in varied environmental conditions, including fluctuating oxygen levels that fungi encounter in their natural habitats.

What are the methods for confirming the successful expression of recombinant cox3 in expression systems?

Confirming successful expression of recombinant E. nidulans cox3 typically involves multiple complementary approaches:

  • SDS-PAGE and Western blotting: Using antibodies specific to either the cox3 protein or to added epitope tags (His-tag, FLAG-tag) to verify the presence of the protein at the expected molecular weight.

  • Mass spectrometry: For definitive identification of the expressed protein through peptide mass fingerprinting or tandem mass spectrometry.

  • Activity assays: Measuring cytochrome c oxidation rates in isolated membrane fractions or purified enzyme preparations. The typical assay involves monitoring the decrease in absorbance at 550 nm as reduced cytochrome c becomes oxidized.

  • Spectroscopic analysis: Cytochrome c oxidases have characteristic absorption spectra due to their heme groups. Difference spectra (reduced minus oxidized) can confirm the presence of properly folded cytochrome c oxidase with incorporated prosthetic groups.

When designing expression systems, researchers should consider that membrane proteins like cox3 often require special conditions for proper folding and integration into membranes.

What expression systems are most effective for producing functional recombinant E. nidulans cox3?

For successful expression of functional recombinant E. nidulans cox3, several expression systems can be considered, each with distinct advantages:

Homologous Expression in E. nidulans: The most physiologically relevant approach, as it provides the native cellular machinery for proper protein folding, membrane insertion, and post-translational modifications. E. nidulans has a well-developed genetics system that allows for DNA-mediated transformation , making it possible to reintroduce modified versions of cox3 for structure-function studies.

Expression in Other Fungal Hosts: Systems like Pichia pastoris or Saccharomyces cerevisiae can offer advantages for higher protein yields while maintaining eukaryotic processing capabilities.

Bacterial Expression Systems: While challenging for integral membrane proteins, specialized E. coli strains designed for membrane protein expression (such as C41(DE3) or C43(DE3)) might be used for producing truncated or modified versions of cox3 for structural studies.

The most effective approach often involves screening multiple expression constructs with varied N- and C-terminal modifications, including:

  • Removal of predicted signal sequences

  • Addition of purification tags (His, FLAG, etc.)

  • Fusion to folding enhancers or solubility tags

  • Codon optimization for the host organism

What purification strategies yield the highest purity and activity for recombinant cox3?

Purification of recombinant cox3 requires specialized strategies due to its membrane-embedded nature:

  • Membrane isolation: Differential centrifugation to isolate membrane fractions enriched in the overexpressed protein.

  • Detergent screening: Testing multiple detergents (DDM, LMNG, digitonin) at various concentrations to identify optimal solubilization conditions that maintain protein activity.

  • Chromatographic steps:

    • Affinity chromatography (if tagged)

    • Ion exchange chromatography

    • Size exclusion chromatography for final polishing

A typical purification scheme might include:

StepMethodBuffer CompositionExpected YieldPurity
1Membrane isolation50 mM phosphate buffer, pH 7.5, protease inhibitors100% (reference)5-10%
2Detergent solubilizationAbove + 1% DDM, 4 hours at 4°C70-80%20-30%
3Ni-NTA (for His-tagged constructs)Above + 0.05% DDM, 20-250 mM imidazole gradient50-60%70-80%
4Size exclusion50 mM phosphate, 150 mM NaCl, 0.03% DDM30-40%>90%

Throughout purification, activity assays should be performed to ensure the protein maintains its functional state. The presence of specific lipids may be required to maintain activity, necessitating careful optimization of detergent and lipid compositions.

How can researchers optimize the expression of recombinant cox3 in E. nidulans?

Optimizing expression of recombinant cox3 in E. nidulans requires careful consideration of multiple factors:

  • Promoter selection: Using either native cox3 promoter for physiological expression levels or inducible promoters (like alcA) for controlled overexpression.

  • Strain selection: E. nidulans strains with well-characterized sexual cycles facilitate genetic manipulation and tracking of the introduced gene through crosses.

  • Growth conditions: Modulating oxygen levels is particularly important as cytochrome c oxidase expression can be oxygen-responsive. Drawing from studies on other organisms, we know that the stability of cytochrome c oxidase can be affected by oxygen levels, as demonstrated in Rhodobacter sphaeroides where the CcoQ subunit protects the core complex from proteolytic degradation in the presence of oxygen .

  • Carbon source: The choice between glucose, glycerol, or ethanol can significantly impact expression levels due to carbon catabolite repression effects on certain promoters.

  • Media supplementation: Addition of heme precursors (such as δ-aminolevulinic acid) or iron sources may enhance production of functional heme-containing proteins.

Monitoring expression throughout the growth curve is essential, as peak expression may occur at specific growth phases depending on the regulatory elements used.

How can cox3 mutational studies provide insights into respiratory adaptation in filamentous fungi?

Mutational analysis of cox3 in E. nidulans can reveal crucial insights into respiratory adaptation mechanisms:

  • Structure-function relationships: Site-directed mutagenesis targeting conserved residues can identify amino acids essential for proton pumping, electron transfer, or subunit interactions.

  • Oxygen adaptation mechanisms: The study of cytochrome c oxidase in Rhodobacter sphaeroides demonstrated that subunit IV (CcoQ) protects the core complex from proteolytic degradation under aerobic conditions . Similar studies in E. nidulans could reveal whether analogous protective mechanisms exist in fungi, potentially explaining how filamentous fungi adapt to fluctuating oxygen levels in soil environments.

  • Respiratory complex assembly: Mutations affecting interaction surfaces between cox3 and other subunits can illuminate the assembly pathway of the complete cytochrome c oxidase complex.

  • Hypoxia adaptation: Since E. nidulans can grow under various oxygen concentrations, mutations in cox3 can help understand how respiratory components adapt to low-oxygen environments.

A comprehensive mutational analysis would typically follow this strategy:

  • Alanine-scanning mutagenesis of conserved regions

  • Targeted mutations based on structural predictions

  • Construction of chimeric proteins with cox3 segments from related species

  • Assessment of each mutant for: assembly into the complex, enzyme activity, oxygen affinity, and proton pumping efficiency

What role does cox3 play in antifungal resistance mechanisms in E. nidulans?

E. nidulans has been recognized as a model system for investigating antifungal resistance due to its tractable sexual cycle . While cytochrome c oxidase is not typically a direct target of current antifungals, it plays several important roles in resistance mechanisms:

  • Metabolic flexibility: Functional respiratory chains allow fungi to adapt to various nutrient conditions and stresses imposed by antifungals. Alterations in cox3 might affect this metabolic plasticity.

  • Energy production for efflux pumps: Many antifungal resistance mechanisms rely on ATP-dependent efflux pumps. The efficiency of the respiratory chain directly impacts ATP availability for these resistance determinants.

  • Redox balance: Cytochrome c oxidase function affects cellular redox state, which can influence the activity of certain antifungals that act through oxidative stress mechanisms.

  • Stress response coordination: Changes in respiratory capacity can trigger broad stress responses that confer cross-resistance to multiple stressors, including antifungal drugs.

Experimental approaches to study these connections might include:

  • Creating cox3 variants with altered activity levels

  • Assessing susceptibility of these variants to different classes of antifungals

  • Measuring efflux pump activity in strains with modified cox3

  • Evaluating redox state and oxidative stress responses in cox3 mutants

How can researchers distinguish between direct effects of cox3 mutations and compensatory responses in E. nidulans?

Distinguishing direct effects of cox3 mutations from secondary compensatory responses represents one of the most challenging aspects of respiratory chain research. Several methodological approaches can help address this challenge:

  • Time-course analyses: Examining phenotypes immediately after inducing a mutation versus after prolonged growth can reveal adaptive responses that develop over time.

  • Transcriptomics and proteomics: Global expression analysis can identify compensatory changes in other pathways. For example, alterations in cox3 might trigger upregulation of alternative oxidases or other respiratory components.

  • Metabolic flux analysis: Using stable isotope-labeled substrates to track carbon flow through different metabolic pathways can reveal shifts in metabolism that compensate for respiratory deficiencies.

  • Genetic interaction studies: Systematic combination of cox3 mutations with mutations in other pathways can reveal functional relationships and compensatory mechanisms.

  • Conditional expression systems: Using regulatable promoters to control cox3 expression allows for acute inactivation studies, minimizing time for compensatory responses to develop.

A typical experimental workflow might involve:

  • Creating a conditional cox3 mutant strain

  • Performing transcriptomic analysis at multiple time points after mutation induction

  • Validating key findings with targeted metabolic assays

  • Confirming direct interactions using biochemical approaches (e.g., cross-linking studies)

How conserved is cox3 across fungal species compared to E. nidulans?

Cytochrome c oxidase subunit 3 (cox3) shows varying degrees of conservation across fungal species, reflecting both evolutionary constraints on core functions and adaptation to different ecological niches:

  • Core catalytic regions: Amino acid residues involved in electron transfer and proton pumping tend to be highly conserved across fungi, reflecting functional constraints.

  • Membrane-spanning domains: Transmembrane regions often show higher conservation of physicochemical properties rather than exact sequence, maintaining structural integrity while allowing sequence drift.

  • Species-specific adaptations: Loops and peripheral regions may show greater divergence, potentially reflecting adaptation to different oxygen tensions or thermal environments.

The E. nidulans genome has been extensively mapped, with 94% of 5,134 cosmids assigned to 49 contiguous segments . This genomic information facilitates comparative analysis of respiratory genes like cox3 across fungal species. Sequence and structural comparisons of cox3 between E. nidulans and other Aspergillus species, filamentous fungi, and more distant fungal lineages can provide insights into the evolution of respiratory mechanisms in fungi.

Interesting patterns might emerge when comparing cox3 sequences from:

  • Aerobic specialists (like many Aspergillus species)

  • Facultative anaerobes (like Saccharomyces cerevisiae)

  • Microaerophilic species (adapted to low oxygen environments)

  • Fungal species from diverse ecological niches

What can horizontal gene transfer analysis tell us about the evolution of respiratory components in E. nidulans?

The genome of A. nidulans displays nonrandom dispersal of repetitive DNA, reminiscent of heterochromatic banding patterns in higher eukaryotes . Researchers have hypothesized that gene clusters may arise by horizontal transfer and spread by transposition, explaining the nonrandom pattern of repeats along chromosomes. This genomic organization may have implications for the evolution of respiratory components like cox3.

Several approaches can be used to investigate potential horizontal gene transfer (HGT) events involving respiratory genes:

  • Phylogenetic incongruence: Constructing gene trees for cox3 and comparing them with species phylogenies can reveal instances where the gene history doesn't match organismal history, suggesting HGT.

  • Composition analysis: Examining GC content, codon usage, and other compositional features of cox3 genes can identify segments that differ from the genomic background, potentially indicating foreign origin.

  • Synteny analysis: Examining the genomic context of cox3 across related species can reveal reorganization events or insertions that might indicate HGT.

  • Distribution patterns: Patchy distribution of specific cox3 variants across taxonomically diverse fungi may suggest HGT rather than vertical inheritance.

The discovery of unexpected evolutionary patterns in respiratory genes could provide insights into fungal adaptation to new environments and potentially identify novel functionalities that could be exploited for biotechnological applications.

How does cox3 function integrate with other metabolic pathways in E. nidulans?

Cytochrome c oxidase function, including the role of cox3, is intricately connected with numerous metabolic pathways in E. nidulans:

  • Primary metabolism: As a terminal electron acceptor in the respiratory chain, cytochrome c oxidase directly influences glycolysis, the TCA cycle, and fatty acid metabolism by affecting NAD+/NADH ratios and ATP production.

  • Secondary metabolism: E. nidulans produces various bioactive compounds, including emericellamide A, an antibiotic compound of mixed polyketide and amino acid origins . The production of these secondary metabolites is often linked to respiratory activity and energy status.

  • Stress response pathways: Respiratory function affects cellular redox balance, which in turn influences various stress response systems, including those involving reactive oxygen species (ROS) signaling.

  • Development and morphogenesis: Energy availability and redox signaling from respiratory activity can influence developmental processes in fungi, including the transition between asexual and sexual reproduction in E. nidulans.

Experimental approaches to study these interconnections might include:

  • Metabolomics analysis of wild-type versus cox3 mutant strains

  • Flux analysis using isotope-labeled substrates

  • Systematic phenotyping of cox3 mutants under various nutrient conditions

  • Investigation of secondary metabolite production in strains with altered cox3 function

What methodologies are most effective for studying cox3 protein-protein interactions in the respiratory chain?

Studying protein-protein interactions involving cox3 in the respiratory chain requires specialized approaches due to the membrane-embedded nature of these complexes:

  • Cross-linking coupled with mass spectrometry (XL-MS): Using bifunctional cross-linkers followed by proteolytic digestion and mass spectrometric analysis to identify interaction partners and specific contact points.

  • Blue native PAGE: Separating intact respiratory complexes under native conditions to preserve physiological interactions, followed by second-dimension separation to identify individual components.

  • Co-immunoprecipitation with detergent optimization: Using mild detergents that preserve protein-protein interactions while solubilizing membrane complexes, followed by immunoprecipitation with cox3-specific antibodies.

  • Proximity labeling approaches: Expressing cox3 fused to enzymes like BioID or APEX2 that can tag nearby proteins, allowing for identification of the proximal proteome.

  • Cryo-electron microscopy: For structural determination of the entire cytochrome c oxidase complex, revealing the precise arrangement of cox3 relative to other subunits.

The comparative approach can be particularly powerful, drawing insights from studies of cytochrome c oxidase in other organisms. For example, research on Rhodobacter sphaeroides has demonstrated specific interactions between subunits that are critical for complex stability, such as the role of CcoQ in protecting the core complex from degradation .

A typical experimental workflow might include:

  • Initial screening for interaction partners using proximity labeling

  • Validation of key interactions using co-immunoprecipitation

  • Detailed mapping of interaction surfaces using cross-linking MS

  • Functional validation through targeted mutagenesis of interaction surfaces

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.