Recombinant Emericella nidulans Mitochondrial intermembrane space import and assembly protein 40 (mia40)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Emericella nidulans Mitochondrial intermembrane space import and assembly protein 40 (Mia40) is a protein involved in the import and assembly of proteins within the mitochondrial intermembrane space . Emericella nidulans (also known as Aspergillus nidulans) is a filamentous fungus that has been used as a model organism to study various biological processes, including secondary metabolism and genetics .

General Information

CharacteristicDescription
OrganismEmericella nidulans (Aspergillus nidulans)
ProteinMitochondrial intermembrane space import and assembly protein 40 (Mia40)
FunctionInvolved in the import and assembly of proteins within the mitochondrial intermembrane space
UniProt IDP0C1D2

Function and Significance

Mia40 plays a crucial role in the import of proteins into the mitochondrial intermembrane space, which is essential for maintaining mitochondrial function . Specifically, Mia40 is involved in the import and stabilization of proteins, and its depletion can lead to reduced levels of its substrate proteins .

One study suggests that Mia40 interacts with apoptosis-inducing factor 1 (AIFM1) to suppress cell death under metabolic stress . An increase in the NADH/NAD+ ratio strengthens the interaction between MIA40 and AIFM1, rendering cells resistant to cell death . This interaction may conceal the nuclear localization sequence (NLS) of AIFM1, potentially inhibiting AIFM1 nuclear translocation and thus preventing cell death .

Role in Metabolic Processes

Mia40 is also involved in the biogenesis of complex I, a crucial component of the mitochondrial respiratory chain . Complex I dysfunction and other metabolic alterations can lead to an increased NADH/NAD+ ratio in the mitochondrial intermembrane space . An increased NADH/NAD+ balance could enhance the AIFM1-MIA40 interaction, possibly to improve Mia40 pathway efficiency to recover complex I biogenesis and the reorganization of cellular metabolism .

Research Findings

  • Emericellamide Biosynthesis: Aspergillus nidulans produces emericellamide A, an antibiotic compound with mixed polyketide and amino acid building blocks . The emericellamide gene cluster contains one polyketide synthase and one nonribosomal peptide synthetase .

  • MIA40 and AIFM1 Interaction: MIA40 interacts with AIFM1, and this interaction is increased in cells with a high NADH/NAD+ ratio, which are resistant to AIFM1-induced cell death .

  • Stabilization of MIA40: The C-terminal region of MIA40 is essential for its efficient import into mitochondria and for stabilizing its substrates . Truncation of MIA40 leads to a reduction in its steady-state levels .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
mia40; tim40; AN11898; Mitochondrial intermembrane space import and assembly protein 40; Mitochondrial import inner membrane translocase TIM40
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-283
Protein Length
Full Length of Mature Protein
Species
Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)
Target Names
mia40
Target Protein Sequence
KPRSWKNTFIRVGLASGAVYYYNTSSVFAETPSLSFRPEAQPKHEDGKSLPTLDSIKPKS REEKKAPAAAADAAATPASTGANAQSESPLKSAEELEAEADQQAAFNPETGEINWDCPCL GGMAYGPCGEEFRAAFSCFVYSEEEPKGMDCIDKFKAMQDCFRAHPDVYGAELDDDEEAG AEANAAGVEQPLAAEVDASVPVEKHEQAKEVRDEVKSAAGEVAESEEVVPKALDVSEQEK TPEQQTEK
Uniprot No.

Target Background

Function

Essential for the import and folding of small cysteine-containing proteins (small Tims) within the mitochondrial intermembrane space (IMS). MIA40 functions in a redox cycle with ERV1, employing a disulfide relay system. Precursor proteins destined for the IMS are translocated in their reduced state into the mitochondria. Oxidized MIA40 forms a transient intermolecular disulfide bridge with the reduced precursor protein, oxidizing the precursor and enabling the formation of an intramolecular disulfide bond, thus facilitating proper folding within the IMS.

Database Links

KEGG: ani:AN6694.2

Subcellular Location
Mitochondrion inner membrane; Single-pass type II membrane protein; Intermembrane side.

Q&A

What is Mia40 and what is its primary function in mitochondria?

Mia40 (Mitochondrial intermembrane space import and assembly protein 40) is an essential component of the mitochondrial disulfide relay system that facilitates the import and oxidative folding of cysteine-containing proteins into the intermembrane space (IMS). Recent studies have demonstrated that Mia40 predominantly serves as a trans-site receptor that binds incoming proteins via hydrophobic interactions, thereby mediating protein translocation across the outer membrane .

In Emericella nidulans (Aspergillus nidulans), like in other fungi, Mia40 plays a critical role in importing and oxidizing small cysteine-rich proteins into the mitochondrial IMS. The functional characterization of E. nidulans Mia40 has revealed conserved mechanisms of action similar to those observed in yeast models, where it functions through a "holding trap" rather than a "folding trap" mechanism .

How does Mia40 facilitate protein import into the mitochondrial intermembrane space?

Mia40 employs a multistep mechanism to facilitate protein import:

  • Recognition and binding: Mia40 recognizes specific internal targeting signals (MISS or ITS sequences) in substrate proteins through its hydrophobic binding pocket

  • Trapping mechanism: The substrate-binding domain of Mia40 is both necessary and sufficient to promote protein import, indicating that trapping by Mia40 drives protein translocation

  • Disulfide bond formation: The CPC motif forms a mixed disulfide intermediate with substrate proteins, where one of the cysteines in the CPC motif forms a disulfide bond with a cysteine in the substrate

  • Oxidative folding: After disulfide bond transfer, the substrate protein folds into its native structure in the IMS

  • Regeneration: Erv1 reoxidizes Mia40 after each substrate interaction, preparing it for another round of import

Experiments with oxidase-deficient Mia40 mutants have demonstrated that the substrate-binding function is more critical for import than the oxidase function, suggesting that Mia40 operates primarily as a "holding trap" that prevents retrograde movement of substrates back to the cytosol .

What methodological approaches can be used to study Mia40-dependent protein import?

MethodologyProcedureApplicationsReference
In vitro import assaysIncubation of purified precursor proteins with isolated mitochondria followed by protease protection assaysAssess import efficiency of various substrates under different conditions
Redox state analysisTreatment with alkylating agents (mmPEG24/mmPEG12) that cause mass shifts in reduced vs. oxidized proteinsDetermine the redox state of Mia40 and substrates
Genetic approachesGeneration of conditional mutants (e.g., mia40-3, erv1-2) or domain-specific mutants (e.g., Mia40-SPS, Mia40-FE)Dissect functional domains and mechanisms
Affinity purificationNi-NTA affinity chromatography with His-tagged Mia40Identify interacting proteins like Erv1
Overexpression studiesComparison of import rates between wild-type and Mia40-upregulated mitochondriaDetermine rate-limiting steps in import
ImmunoprecipitationPull-down of Mia40-substrate conjugatesIdentify transient import intermediates

A combination of these approaches allows comprehensive characterization of E. nidulans Mia40 function in protein import and folding.

How does E. nidulans Mia40 compare to Mia40 in other organisms?

Significant variations exist in Mia40 structure and targeting across different organisms:

  • Fungi (including E. nidulans): In most fungi, Mia40 is synthesized as a larger protein with an N-terminal presequence that directs it to mitochondria via the presequence pathway . A hydrophobic segment following the presequence anchors it to the inner membrane .

  • Metazoans and plants: Mia40 (called MIA40 in humans) consists only of the conserved C-terminal domain without the presequence . It is smaller and not attached to the inner membrane.

  • Arabidopsis thaliana: Shows novel functions for Mia40, including roles in both mitochondria and peroxisomes . Inactivation of Mia40 in A. thaliana affects copper/zinc superoxide dismutase (CSD) levels in both organelles.

Despite these differences, the core functional domain containing the CPC motif and substrate-binding region is conserved across species, suggesting evolutionary conservation of the fundamental mechanism .

Can the core domain of Mia40 function independently of the full-length protein?

Experimental evidence demonstrates that the C-terminal domain of Mia40 (termed Mia40core) can function independently:

  • In yeast, both human MIA40 and the C-terminal domain of yeast Mia40 (Mia40core) rescued the viability of Mia40-deficient yeast, independent of the presence of a presequence

  • Purified Mia40core can be imported into mitochondria via the MIA pathway rather than the presequence pathway that imports full-length Mia40

  • Mia40core forms conjugates with precursor proteins and can oxidize imported substrates with efficiency similar to full-length Mia40

  • The import of Mia40core depends on functional Mia40 and Erv1, as demonstrated by impaired import in mia40-3, erv1-2, and erv1-5 mutant mitochondria

These findings indicate that E. nidulans Mia40's core domain likely contains all essential functional elements, similar to other fungal Mia40 proteins.

How do mutations in different domains of Mia40 differentially affect its function?

Studies with yeast Mia40 reveal domain-specific functional impacts of mutations:

DomainMutationFunctional ImpactViabilityReference
CPC motifCys→Ser (Mia40-SPS)Abolishes oxidase activity but maintains import functionInviable but rescuable by chemical oxidants
Substrate-binding domainHydrophobic residue replacements (Mia40-FE)Prevents formation of structural disulfides and impairs substrate bindingGrowth defects, impaired substrate assembly
Substrate-binding domainComplete removal (Mia40-STOP)Loss of substrate binding capacityNon-functional

These differential effects demonstrate that while both domains are essential for complete Mia40 function, the substrate-binding activity is the primary driver of protein import, with oxidase activity contributing to subsequent protein stabilization. Similar domain-function relationships likely exist in E. nidulans Mia40.

How does overexpression of Mia40 affect mitochondrial protein import and cellular proteostasis?

Overexpression of Mia40 has significant effects on both mitochondrial function and cellular proteostasis:

  • Enhanced import efficiency: Upregulation of Mia40 considerably improves the import of various IMS proteins, including Cmc1, Atp23, and Tim9

  • Increased substrate levels: Higher Mia40 levels lead to increased steady-state levels of many Mia40 substrates, suggesting Mia40 is rate-limiting for import

  • Protection against proteotoxicity: Increased Mia40 levels counteract the formation of protein aggregates by aggregation-prone proteins like polyQ proteins and prion-like Rnq1

  • Mitochondrial morphology changes: Co-expression of Mia40 and aggregation-prone proteins induces changes in mitochondrial morphology, forming large circular structures in both yeast and mammalian cells

  • Specificity to import pathways: Upregulation of Mia40 specifically enhances the MIA pathway without improving import via other pathways, and may even reduce import of some presequence pathway substrates like cytochrome b2

These findings suggest that modulating Mia40 levels serves as a molecular mechanism to fine-tune cytosolic protein homeostasis, with potential therapeutic implications for proteotoxic diseases .

What are the specific applications of recombinant E. nidulans Mia40 in research?

Recombinant E. nidulans Mia40 provides several advantages for mitochondrial import research:

  • Structural studies: The availability of purified recombinant protein facilitates structural analyses using X-ray crystallography or NMR, similar to studies done with yeast Mia40

  • Comparative biochemistry: E. nidulans (Aspergillus nidulans) is a model organism with both asexual and sexual reproductive capabilities , making it valuable for comparative studies of Mia40 function across fungal species

  • Disulfide relay reconstitution: Recombinant Mia40 can be used to reconstitute the disulfide relay system in vitro, allowing detailed mechanistic studies of substrate oxidation

  • Protein-protein interaction studies: His-tagged recombinant E. nidulans Mia40 can be used for affinity purification of interaction partners from mitochondrial extracts

  • Heterologous expression systems: Testing whether E. nidulans Mia40 can complement Mia40 deficiency in other organisms, providing insights into functional conservation

E. nidulans also produces various natural products of mixed polyketide and amino acid origins , making it an interesting model to study potential connections between mitochondrial function and secondary metabolism.

How can researchers troubleshoot issues with recombinant Mia40 activity?

IssuePossible CausesTroubleshooting ApproachReference
Loss of oxidase activityImproper disulfide bond formationAvoid repeated freeze-thaw cycles; store working aliquots at 4°C for up to one week
AggregationImproper folding during recombinant expressionReconstitute in deionized sterile water to 0.1-1.0 mg/mL; add 5-50% glycerol (final concentration) for long-term storage
Reduced binding capacityStructural changes in the hydrophobic pocketUse Tris/PBS-based buffer at pH 8.0 with 6% trehalose for storage
Inconsistent import assay resultsVariable redox state of Mia40Precipitate proteins with trichloroacetic acid (TCA) to preserve redox state before analysis
Poor substrate oxidationInactive Mia40Consider adding chemical oxidants like diamide to restore function

For reproducible results, researchers should validate the activity of recombinant E. nidulans Mia40 by testing its ability to form mixed disulfides with model substrates before using it in complex experimental setups.

What are the emerging roles of Mia40 beyond canonical protein import?

Recent research has uncovered several non-canonical functions of Mia40:

  • Peroxisomal roles: In Arabidopsis thaliana, Mia40 localizes to and functions in peroxisomes, affecting levels of peroxisomal copper/zinc superoxide dismutase (CSD3) and β-oxidation pathway enzymes

  • Proteostasis regulation: Mia40 levels influence the cell's ability to handle aggregation-prone proteins, suggesting a role in cytosolic quality control

  • Transcriptome effects: Inactivation of Mia40 leads to alterations in the transcriptome, with genes encoding peroxisomal proteins, redox functions, and biotic stress significantly changing in abundance

  • Dual-targeting mechanism: Yeast Mia40 contains dual targeting information, directing the large precursor onto the presequence pathway and the smaller Mia40core onto the MIA pathway

These findings suggest E. nidulans Mia40 may have functions beyond its canonical role in mitochondrial protein import, potentially influencing cellular processes through mechanisms that remain to be fully elucidated.

How does the interaction between Mia40 and Erv1 regulate the disulfide relay system?

The Mia40-Erv1 interaction is central to the function of the disulfide relay system:

  • Oxidation cycle: Erv1 reoxidizes Mia40 after Mia40 has transferred disulfide bonds to substrate proteins, regenerating active Mia40

  • Binding mechanism: The hydrophobic substrate-binding region of Mia40 is essential for binding to both substrates and Erv1

  • Functional interdependence: Conditional mutants of ERV1 (erv1-2, erv1-5) show strongly inhibited import of Mia40 substrates, demonstrating the essential nature of this interaction

  • Rate-limiting factors: While both Mia40 and Erv1 are essential, Mia40 appears more rate-limiting, as its overexpression increases substrate levels whereas modulating Erv1 levels has limited effect

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.