Recombinant Emericella nidulans NADH-cytochrome b5 reductase 1 (cbr1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
cbr1; AN6366; NADH-cytochrome b5 reductase 1; Microsomal cytochrome b reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)
Target Names
cbr1
Target Protein Sequence
MSALSLENITGVYAPSALLVVGTFILKKEWVPFAVALAAGFVAWKLSVGGSSKPRKVLNP NEFQNFVLKEKNDISHNVTIYRFALPRPTDILGLPIGQHISLAATIEGQPKEVVRSYTPI SSDNEAGYFDLLVKAYPQGNISKYLTTLKVGDTMKVRGPKGAMVYTPNMCRHIGMIAGGT GITPMLQIIKAIIRNRPRNGGNDTTQVDLIFANVNPDDILLKDELEKLAAEDDGFRIYYV LNNPPEGWTGGVGFVTPDMIKERLPAPASDIKILLCGPPPMVSAMKKATESLGYTKARPV SKLEDQVFCF
Uniprot No.

Target Background

Function
Electron donor reductase for cytochrome b5. The cytochrome b5/NADH cytochrome b5 reductase electron transfer system is essential for the catalytic activity of several sterol biosynthetic enzymes.
Database Links
Protein Families
Flavoprotein pyridine nucleotide cytochrome reductase family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion outer membrane; Single-pass membrane protein.

Q&A

What is NADH-cytochrome b5 reductase 1 (cbr1) from Emericella nidulans and what are its primary functions?

NADH-cytochrome b5 reductase 1 from Emericella nidulans (also referred to as Aspergillus nidulans) is a flavoprotein enzyme classified under EC 1.6.2.2 that catalyzes electron transfer reactions, serving as microsomal cytochrome b reductase . The protein functions primarily in electron transfer from NADH to cytochrome b5, playing critical roles in various metabolic pathways including fatty acid elongation, cholesterol biosynthesis, and cytochrome P450-mediated reactions. The enzyme from Emericella nidulans is encoded by the cbr1 gene (ORF name: AN6366) and produces a full-length protein comprising 310 amino acid residues .

Research on related NADH-cytochrome b5 reductases from other fungal species, such as Mortierella alpina, has demonstrated that these enzymes exhibit a preference for NADH over NADPH as an electron donor, which suggests similar cofactor specificity for the E. nidulans enzyme . This specificity is vital for understanding the enzyme's role in cellular redox pathways and for designing experimental approaches to study its activity.

The structural characteristics of NADH-cytochrome b5 reductases typically include a flavin-binding β-barrel domain with highly conserved amino acid residues (specifically arginine, tyrosine, and serine) that form hydrogen bonds with the flavin prosthetic group . These conserved structural features are crucial for maintaining enzymatic function and provide important targets for structure-function analysis studies.

What are the optimal storage and handling conditions for recombinant E. nidulans NADH-cytochrome b5 reductase 1?

The optimal storage conditions for recombinant Emericella nidulans NADH-cytochrome b5 reductase 1 are critical for maintaining enzymatic activity and structural integrity. According to product specifications, the recombinant protein should be stored at -20°C for regular use, while extended storage requires conservation at either -20°C or -80°C . The enzyme is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized to stabilize the protein's native conformation and prevent denaturation during freeze-thaw cycles .

For working with the enzyme, it is strongly recommended to prepare small working aliquots that can be stored at 4°C for up to one week to minimize protein degradation from repeated freeze-thaw cycles . When preparing these aliquots, researchers should use sterile technique and appropriate buffer conditions that maintain the enzyme's pH optimum, typically around neutral pH.

Temperature sensitivity is a significant consideration when handling this enzyme. Exposure to temperatures above 4°C for extended periods should be avoided during experiments as this can lead to accelerated denaturation and loss of activity. Additionally, researchers should be mindful of potential oxidative damage to the flavin prosthetic group, which may occur upon prolonged exposure to light or oxidizing agents.

How can researchers accurately assay the activity of NADH-cytochrome b5 reductase 1?

Accurate assessment of NADH-cytochrome b5 reductase 1 activity can be achieved through several established spectrophotometric methods that monitor the enzyme's electron transfer capabilities. The most commonly employed approach is the NADH-dependent ferricyanide reduction assay, which measures the rate at which the enzyme transfers electrons from NADH to potassium ferricyanide . This assay is conducted in 0.1 M potassium phosphate buffer (pH 7.5) containing 10^-3 M NADH and 10^-3 M ferricyanide in a final volume of 1 ml . The reduction of ferricyanide is monitored by measuring the decrease in absorbance at 420 nm, utilizing an extinction coefficient of 1.02 mM^-1 cm^-1 . One unit of enzyme activity is defined as the amount that catalyzes the reduction of 1 μmol of ferricyanide per minute.

An alternative method involves measuring NADH-2,6-dichlorophenol-indophenol (DCPIP) reductase activity. This assay monitors the change in optical density at 600 nm using a reaction mixture containing 10^-3 M NADH, 10^-4 M DCPIP, and the enzyme in 2 ml of 0.1 M potassium phosphate buffer (pH 7.5) . For this method, the molar extinction coefficient of oxidized DCPIP at 600 nm is 21.0 mM^-1 cm^-1 .

When conducting these assays, researchers should carefully control several experimental parameters:

  • Temperature stability: Assays should be performed at a constant temperature, typically 25°C or 37°C, with appropriate temperature controls.

  • pH optimization: While pH 7.5 is standard, researchers may need to determine the optimal pH for specific experimental conditions.

  • Substrate concentration: Kinetic parameters (K_m, V_max) should be determined by varying NADH concentration to ensure optimal assay conditions.

  • Enzyme concentration: Linear relationship between enzyme concentration and activity should be established to determine appropriate enzyme dilutions.

For more sensitive detection, particularly when working with crude extracts or partially purified enzyme preparations, HPLC-based methods that directly measure NADH consumption or cytochrome b5 reduction may provide superior resolution and specificity.

What are the most effective strategies for purifying recombinant NADH-cytochrome b5 reductase 1?

Effective purification of recombinant NADH-cytochrome b5 reductase 1 requires a strategic multi-step approach that accounts for the enzyme's biochemical properties and localization. Based on successful purification methods applied to related enzymes, a comprehensive purification strategy begins with proper solubilization of the microsomal fraction where the enzyme is typically localized . For instance, the NADH-cytochrome b5 reductase from Mortierella alpina was effectively solubilized from microsomes using cholic acid sodium salt, which maintains protein structure while releasing membrane-bound proteins .

Following solubilization, a series of chromatographic steps can achieve significant purification. An effective sequence includes:

  • Ion-exchange chromatography using DEAE-Sephacel, which separates proteins based on charge differences and serves as an initial broad-specificity purification step .

  • High-resolution anion exchange chromatography on Mono-Q HR 5/5 columns, which provides finer separation based on subtle charge differences between proteins .

  • Affinity chromatography using AMP-Sepharose 4B, which exploits the enzyme's affinity for adenine nucleotides and typically yields the highest purification factor .

This sequential purification approach has been demonstrated to achieve a 645-fold increase in specific activity for related NADH-cytochrome b5 reductases . Throughout the purification process, activity should be monitored using the NADH-ferricyanide reduction assay to track enzyme recovery and specific activity enhancement.

For recombinant proteins expressed with affinity tags, specialized purification strategies can be employed. While the exact tag type for commercial recombinant E. nidulans NADH-cytochrome b5 reductase 1 is determined during the production process , common approaches include immobilized metal affinity chromatography (IMAC) for His-tagged proteins or glutathione affinity chromatography for GST-fusion proteins. These tag-based methods can significantly streamline the purification process, though researchers should verify that the tag does not interfere with enzymatic activity or structural integrity.

Protein purity should be assessed after each purification step using SDS-PAGE analysis , and the final product can be confirmed by western blotting and N-terminal sequencing to verify protein identity and integrity.

What expression systems are most suitable for producing functional recombinant NADH-cytochrome b5 reductase 1?

The selection of an appropriate expression system for producing functional recombinant NADH-cytochrome b5 reductase 1 depends on several factors including protein folding requirements, post-translational modifications, and desired yield. Based on successful expression strategies for related enzymes, filamentous fungi represent particularly suitable hosts for expressing fungal NADH-cytochrome b5 reductases .

Aspergillus oryzae has been demonstrated as an effective expression system for NADH-cytochrome b5 reductase from Mortierella alpina, resulting in a 4.7-fold increase in ferricyanide reduction activity when using NADH as an electron donor in microsomes . This system utilizes the promoter region of the glucoamylase gene (glaA) and the terminator region of the α-glucosidase gene (agdA) to drive high-level expression . For optimal expression in this system, the sequence upstream from the ATG start codon should be modified to CCACCATG, which is commonly observed at translational start sites in eukaryotes .

Other potential expression systems include:

When designing expression constructs, several considerations are important:

  • Codon optimization: Adapting the coding sequence to the preferred codon usage of the host organism can significantly enhance expression levels.

  • Signal sequences: Inclusion of appropriate signal peptides can direct protein localization to microsomes or facilitate secretion for easier purification.

  • Fusion partners: Solubility-enhancing fusion partners or affinity tags can improve protein folding and simplify purification.

To verify successful expression, researchers should assess both protein production (via SDS-PAGE and western blotting) and enzymatic activity (using NADH-ferricyanide or NADH-DCPIP reduction assays) . For enzymes intended for crystallographic studies, additional purification steps may be necessary to achieve the required homogeneity.

How does E. nidulans NADH-cytochrome b5 reductase 1 compare structurally and functionally to orthologs from other species?

NADH-cytochrome b5 reductase 1 from Emericella nidulans shares significant structural and functional similarities with orthologs from various species while maintaining distinct characteristics. Comparative analysis reveals marked sequence similarities between E. nidulans cbr1 and NADH-cytochrome b5 reductases from other organisms including yeast (Saccharomyces cerevisiae), bovine, human, and rat sources . This conservation suggests evolutionary pressure to maintain core functional elements of these enzymes across diverse taxonomic groups.

The genomic organization of NADH-cytochrome b5 reductase genes also shows interesting variations across species. While detailed information on E. nidulans cbr1 gene structure is limited in the provided search results, related enzymes such as that from Mortierella alpina contain multiple introns of varying sizes . These introns typically follow the GT-AG splicing rule (GT at the 5′ end and AG at the 3′ end), consistent with canonical eukaryotic splicing mechanisms .

What are the key structural determinants for substrate specificity in NADH-cytochrome b5 reductase 1?

The substrate specificity of NADH-cytochrome b5 reductase 1 is determined by several key structural elements that collectively shape the enzyme's active site geometry and electrostatic environment. Analysis of conserved domains and structural comparisons with related enzymes reveals critical determinants that influence both NADH binding and interaction with electron acceptors.

The enzyme's preference for NADH over NADPH as an electron donor is primarily determined by specific residues in the nucleotide-binding domain that form hydrogen bonds and electrostatic interactions with the adenine dinucleotide portion of the substrate. The 2'-phosphate group present in NADPH but absent in NADH likely creates steric hindrance or unfavorable charge interactions within the binding pocket, explaining the observed cofactor specificity.

The flavin-binding β-barrel domain contains a specific arrangement of three highly conserved amino acid residues—arginine, tyrosine, and serine—that form hydrogen bonds with the flavin prosthetic group . This interaction is crucial for properly positioning the flavin for electron transfer from NADH to various electron acceptors. Mutations in these conserved residues would likely disrupt electron transfer efficiency or alter substrate specificity.

For interaction with cytochrome b5 and other electron acceptors, surface residues create an interaction interface that facilitates proper alignment for efficient electron transfer. This interface typically involves complementary electrostatic interactions between oppositely charged residues on the reductase and its electron acceptor partners.

The enzyme's ability to utilize alternative electron acceptors such as ferricyanide and DCPIP in experimental assays indicates a certain degree of flexibility in the electron transfer pathway. This flexibility likely stems from the accessible positioning of the flavin prosthetic group and the presence of a relatively open electron transfer channel that can accommodate various electron acceptors of appropriate redox potential.

Understanding these structural determinants has important implications for protein engineering efforts aimed at modifying substrate specificity or enhancing catalytic efficiency for biotechnological applications. Site-directed mutagenesis targeting residues in the NADH-binding pocket or at the electron acceptor interface could potentially alter the enzyme's substrate preference or reaction kinetics.

How can researchers effectively design expression vectors for heterologous production of NADH-cytochrome b5 reductase 1?

Designing effective expression vectors for heterologous production of NADH-cytochrome b5 reductase 1 requires careful consideration of several elements that influence protein expression, folding, and activity. Based on successful strategies with related enzymes, researchers should incorporate the following key components into their vector design:

For expression in filamentous fungi such as Aspergillus oryzae, a shuttle vector system that carries appropriate selection markers for both the cloning host (e.g., ampicillin resistance for E. coli) and the expression host (e.g., nitrate assimilation genes like niaD for A. oryzae) has proven effective . The vector should contain strong, preferably inducible promoters such as the glucoamylase gene (glaA) promoter and appropriate terminator sequences like the α-glucosidase gene (agdA) terminator .

The coding sequence should be optimized with the following modifications:

  • The sequence around the start codon should be modified to CCACCATG, which is typically observed at translational start points in eukaryotes and enhances translation efficiency .

  • Codon optimization for the expression host should be considered to improve translation efficiency.

  • Addition of appropriate restriction sites (such as HindIII and XbaI) flanking the gene of interest facilitates cloning into the expression vector .

For PCR-based cloning strategies, researchers should design primers that incorporate:

  • Appropriate restriction sites for directional cloning (underlined in the example: 5′-GCGACAAGCTTCCACCATGACTCTGTCC-3′) .

  • The optimized Kozak sequence (CCACCATG) for efficient translation initiation .

  • Sufficient overlap with the target gene sequence (at least 18-20 nucleotides) to ensure specific amplification .

After construction, expression vectors should be verified by DNA sequencing to confirm that the gene of interest is correctly inserted and free of mutations. For transformation into the expression host, highly purified plasmid DNA prepared by methods such as CsCl-ethidium bromide equilibrium centrifugation is recommended to improve transformation efficiency .

The expression vector design should also consider the potential need for fusion partners or affinity tags to facilitate purification or improve solubility, though careful assessment is necessary to ensure these additions do not interfere with enzyme activity.

What are the common challenges in studying NADH-cytochrome b5 reductase 1 and how can they be addressed?

Researchers investigating NADH-cytochrome b5 reductase 1 encounter several technical and conceptual challenges that can impact experimental outcomes. Understanding these challenges and implementing appropriate mitigation strategies is essential for successful research in this area.

Protein Solubility and Membrane Association:
NADH-cytochrome b5 reductase 1 is typically associated with microsomal membranes, which can complicate its extraction and purification. Researchers can address this challenge by:

  • Using appropriate detergents such as cholic acid sodium salt for solubilization while preserving enzyme structure and activity .

  • Employing sequential chromatographic techniques (ion-exchange, high-resolution anion exchange, and affinity chromatography) to achieve high purification factors .

  • Considering expression of truncated forms lacking membrane-binding domains when studying catalytic mechanisms.

Maintaining Enzyme Stability:
The enzyme's stability can be compromised during storage and experimental manipulation. To preserve activity:

  • Store the enzyme at -20°C or -80°C in buffer containing 50% glycerol, which stabilizes protein structure .

  • Prepare working aliquots for short-term storage at 4°C to avoid repeated freeze-thaw cycles .

  • Include appropriate cofactors or stabilizing agents in storage buffers.

Assay Interference and Specificity:
Activity assays can be affected by interfering compounds or competing enzymatic activities in complex biological samples. Researchers can improve assay specificity by:

  • Using purified enzyme preparations when possible.

  • Including appropriate controls to account for non-enzymatic reduction of electron acceptors.

  • Employing multiple assay methods (e.g., both ferricyanide and DCPIP reduction) to cross-validate activity measurements .

Expression System Limitations:
Heterologous expression systems may not always produce correctly folded, active enzyme. This challenge can be addressed by:

  • Selecting expression hosts with appropriate post-translational modification capabilities, such as filamentous fungi for fungal enzymes .

  • Optimizing expression conditions including temperature, induction parameters, and growth media composition.

  • Co-expressing molecular chaperones or modifying redox conditions to improve correct folding.

Structure-Function Analysis Complexities:
Determining the specific roles of individual amino acid residues in catalysis can be challenging. Researchers can employ:

  • Site-directed mutagenesis targeting conserved residues in the flavin-binding domain (particularly the arginine, tyrosine, and serine residues) to assess their contributions to catalytic function .

  • Comparative analyses of enzymes from different species to identify functionally important conserved residues .

  • Computational modeling and molecular dynamics simulations to predict effects of mutations or substrate interactions.

By anticipating these challenges and implementing appropriate experimental strategies, researchers can effectively investigate the structural features and enzymatic mechanisms of NADH-cytochrome b5 reductase 1.

How can researchers troubleshoot inconsistent activity measurements of NADH-cytochrome b5 reductase 1?

Enzyme Stability and Storage Issues:
Activity fluctuations often result from protein degradation or denaturation. Researchers should:

  • Verify storage conditions, ensuring the enzyme is maintained at -20°C or -80°C in buffer containing 50% glycerol .

  • Examine freeze-thaw history, as repeated cycles can dramatically reduce activity.

  • Prepare fresh working aliquots for each experimental session, storing them at 4°C for no more than one week .

  • Consider adding reducing agents (e.g., DTT) at low concentrations to prevent oxidative damage to critical cysteine residues.

Assay Component Variability:
Inconsistencies in assay reagents can significantly impact measurements. Researchers should:

  • Prepare fresh NADH solutions for each experiment, as this cofactor is susceptible to oxidation.

  • Standardize buffer preparation, ensuring consistent pH (typically 7.5 for NADH-ferricyanide reduction assays) .

  • Calibrate spectrophotometers using appropriate standards to ensure accurate absorbance readings.

  • Prepare consistent concentrations of electron acceptors (e.g., 10^-3 M ferricyanide or 10^-4 M DCPIP) .

Interference and Inhibition:
Various compounds can interfere with activity measurements or inhibit the enzyme:

  • Test for potential interfering substances in buffers or sample preparations.

  • Consider the presence of endogenous inhibitors in crude extracts or partially purified preparations.

  • Examine the effect of different detergents used during enzyme extraction on activity measurements.

  • Develop and apply correction factors for known interferences when working with complex samples.

Technical Execution Variability:
Inconsistencies in measurement techniques can introduce significant variability:

  • Standardize the order of reagent addition and mixing protocols.

  • Control reaction temperature precisely, as enzymatic rates are highly temperature-dependent.

  • Establish consistent time windows for measurements, particularly for initial rate determinations.

  • Consider automated assay platforms to reduce operator-dependent variability.

Diagnostic Approaches for Systematic Troubleshooting:
When facing persistent inconsistencies, researchers should implement a systematic diagnostic approach:

  • Perform activity measurements using a well-characterized reference enzyme preparation as a positive control.

  • Conduct recovery experiments by adding known amounts of purified enzyme to test samples.

  • Analyze the relationship between enzyme concentration and measured activity to verify linearity within the working range.

  • Perform parallel assays using alternative electron acceptors (comparing ferricyanide and DCPIP reduction rates) to identify acceptor-specific issues .

By methodically evaluating these potential sources of variability, researchers can identify and address the specific factors causing inconsistent activity measurements, leading to more reliable and reproducible experimental results.

What approaches can resolve conflicting data in structure-function studies of NADH-cytochrome b5 reductase 1?

Resolving conflicting data in structure-function studies of NADH-cytochrome b5 reductase 1 requires a systematic, multi-faceted approach that addresses potential sources of discrepancy while integrating diverse experimental methodologies. When confronted with contradictory findings regarding the relationship between enzyme structure and function, researchers should implement the following resolution strategies:

Reconciliation Through Methodological Triangulation:
Different experimental approaches can yield apparently conflicting results due to inherent methodological limitations. Researchers should:

  • Employ multiple, complementary techniques to investigate the same structural or functional question.

  • Compare site-directed mutagenesis data with computational predictions and structural analyses.

  • Correlate in vitro biochemical findings with in vivo functional studies when possible.

  • Consider whether discrepancies result from differences in experimental conditions rather than fundamental biological disagreements.

Critical Evaluation of Experimental Foundations:
Many conflicts arise from variations in experimental systems or reagents:

  • Examine differences in protein expression systems between studies, as post-translational modifications or folding environments can significantly impact structure-function relationships .

  • Assess whether conflicting studies used the full-length enzyme versus truncated constructs, as membrane-binding domains can influence catalytic properties.

  • Compare purification methodologies, as different approaches may selectively enrich particular conformational states or isoforms .

  • Evaluate whether the flavin prosthetic group is fully incorporated and correctly positioned in all experimental systems being compared.

Resolution Through Advanced Structural Analysis:
When functional data conflicts with structural predictions:

  • Employ multiple structural determination methods (X-ray crystallography, cryo-EM, NMR) to capture potential conformational heterogeneity.

  • Consider whether the enzyme adopts different conformations during the catalytic cycle that may explain functional discrepancies.

  • Analyze the specific arrangement of conserved residues (arginine, tyrosine, and serine) in the flavin-binding domain across experimental systems to identify potential structural variations .

  • Use molecular dynamics simulations to explore conformational flexibility not captured in static structural models.

Systematic Comparative Analysis:
Leveraging evolutionary conservation can help resolve conflicting data:

  • Conduct comparative studies of orthologous enzymes from different species to determine whether conflicting results reflect species-specific adaptations .

  • Examine sequence alignments to identify conserved versus variable regions that may explain functional differences.

  • Create chimeric enzymes combining domains from different species to pinpoint regions responsible for conflicting functional observations.

  • Correlate sequence conservation patterns with structural features and catalytic properties across the enzyme family.

Collaborative Validation and Standardization:
When interlaboratory discrepancies persist:

  • Establish standardized protocols for enzyme expression, purification, and activity assays to facilitate direct comparisons between research groups.

  • Implement round-robin testing of the same enzyme preparations across different laboratories.

  • Develop shared reference standards for activity measurements and structural analyses.

  • Consider whether conflicting data might actually reveal important regulatory mechanisms or environmental sensitivities of the enzyme.

By systematically applying these resolution strategies, researchers can transform seemingly contradictory findings into complementary insights that collectively advance understanding of NADH-cytochrome b5 reductase 1 structure-function relationships.

What are the emerging research opportunities for NADH-cytochrome b5 reductase 1 in biotechnology and medicine?

NADH-cytochrome b5 reductase 1 presents several promising research frontiers at the intersection of fundamental enzymology, biotechnology, and potential medical applications. As our understanding of this enzyme's structure and function continues to expand, several high-potential research directions are emerging that warrant further investigation.

In biocatalysis applications, the enzyme's ability to catalyze electron transfer reactions with high specificity makes it an attractive candidate for oxidoreduction biotransformations. Researchers can explore its potential in the synthesis of high-value chemicals, pharmaceuticals, or biofuels where specific redox transformations are required. The preference of NADH-cytochrome b5 reductase for NADH over NADPH as an electron donor provides opportunities for developing NADH-regeneration systems in coupled enzymatic reactions, potentially enhancing the economic feasibility of biocatalytic processes.

For structural biology and protein engineering, the conserved flavin-binding β-barrel domain offers an excellent scaffold for rational design of modified enzymes with altered substrate specificities or enhanced stabilities. Researchers could target the specific arrangement of conserved amino acid residues (arginine, tyrosine, and serine) that interact with the flavin prosthetic group to modulate electron transfer rates or redirect electron flow to non-native acceptors, potentially creating novel biocatalysts for synthetic biology applications.

In comparative genomics and evolutionary studies, the well-conserved structure of NADH-cytochrome b5 reductase across diverse species provides an opportunity to investigate the evolution of electron transfer systems and their adaptation to different metabolic contexts. The genomic organization of the cbr1 gene with multiple introns also presents interesting questions about the evolution of gene structure and potential alternative splicing mechanisms in different organisms.

For fungal biology and biotechnology, understanding the specific roles of NADH-cytochrome b5 reductase 1 in filamentous fungi could inform strategies for metabolic engineering of these organisms for enhanced production of valuable compounds. The successful heterologous expression of the enzyme in Aspergillus oryzae demonstrates the feasibility of manipulating this system for biotechnological applications.

In systems biology approaches, integrating knowledge about NADH-cytochrome b5 reductase 1 into broader metabolic networks could reveal its contributions to cellular redox homeostasis, fatty acid metabolism, and stress responses. This systems-level understanding could identify potential intervention points for modulating fungal metabolism or developing novel antifungal strategies targeting these essential redox pathways.

What methodological advances are needed to address current knowledge gaps about NADH-cytochrome b5 reductase 1?

Significant methodological advances are required to address persistent knowledge gaps regarding NADH-cytochrome b5 reductase 1, particularly concerning its in vivo dynamics, regulatory mechanisms, and broader metabolic integration. These technological and conceptual developments would substantially enhance our understanding of this important enzyme and its biological functions.

In the area of structural characterization, time-resolved structural analysis methods are needed to capture the dynamic conformational changes that occur during the catalytic cycle. Current structural information primarily provides static snapshots, whereas advanced techniques such as time-resolved X-ray crystallography, hydrogen-deuterium exchange mass spectrometry, or single-molecule FRET could reveal the transient states that are essential for understanding the complete reaction mechanism. Additionally, improved computational approaches for modeling protein-lipid interactions would help elucidate how membrane association influences the enzyme's structure and activity.

For in vivo activity measurement, developing specific fluorescent or bioluminescent reporters that respond to NADH-cytochrome b5 reductase activity would enable real-time monitoring of the enzyme's function in living cells. Current activity assays primarily rely on in vitro measurements using artificial electron acceptors such as ferricyanide or DCPIP , which may not accurately reflect physiological electron transfer pathways. Complementing these approaches with in-cell NMR techniques could provide insights into the enzyme's behavior in its native cellular environment.

Regarding regulatory mechanisms, systematic approaches for identifying post-translational modifications and their functional consequences are needed. While the primary sequence and basic enzymatic properties of NADH-cytochrome b5 reductase 1 are well-characterized , little is known about how its activity is regulated in response to changing cellular conditions. Advances in targeted proteomics and modification-specific antibodies would facilitate investigation of how phosphorylation, acetylation, or other modifications affect enzyme function.

In genetic manipulation capabilities, development of more precise genome editing techniques for filamentous fungi would facilitate detailed structure-function studies in native hosts. While heterologous expression in systems like Aspergillus oryzae has been successful , studying the enzyme in its native genetic context would provide more physiologically relevant insights. CRISPR-Cas9 systems optimized for various fungal species would enable more sophisticated genetic manipulations than currently possible.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.