Recombinant Emericella nidulans NADH-ubiquinone oxidoreductase chain 3 (nd3)

Shipped with Ice Packs
In Stock
Cat. No.
BT2445223
Source
in vitro E.coli expression system
Synonyms
nd3; ndhC; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Quick Inquiry

Description

Functional Role in Mitochondrial Complex I

nd3 is a core subunit of Complex I, facilitating electron transfer from NADH to ubiquinone . Its role includes:

  • Electron Transport: Directly involved in the proton-pumping mechanism of Complex I .

  • Disease Association: Mutations in homologous human MT-ND3 (P03897) are linked to Leber hereditary optic neuropathy and Leigh syndrome .

Production and Purification

The recombinant protein is produced via bacterial expression systems, optimized for high yield and stability:

ParameterSpecification
Expression HostE. coli
TagN-terminal His-tag
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for storage
StabilityAvoid freeze-thaw cycles; store at -20°C/-80°C

Applications in Research

The recombinant nd3 protein serves as a critical tool in:

  • Complex I Studies: Used to investigate subunit interactions and catalytic mechanisms .

  • Diagnostic Reagents: Employed in ELISA or Western blot assays for detecting Complex I dysfunction .

  • Metabolic Research: Linked to energy metabolism pathways, including gluconeogenesis and glycolysis regulation .

Comparative Analysis with Human Homologs

While E. nidulans nd3 shares structural homology with human MT-ND3, key differences exist:

FeatureE. nidulans nd3 (P15956)Human MT-ND3 (P03897)
Expression SystemE. coliMitochondrial gene-encoded
Disease RelevanceModel for fungal Complex I studiesDirectly implicated in human diseases
Functional StudiesLimited to biochemical assaysClinical diagnostics and therapy

Research Challenges and Future Directions

  • Structural Elucidation: High-resolution crystallography data remains limited for full-length nd3 .

  • Functional Interactions: Studies on subunit assembly dynamics within Complex I are needed .

  • Biotechnological Applications: Potential for optimizing expression in Aspergillus nidulans via gpdA promoter-driven systems .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
nd3; ndhC; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-136
Protein Length
full length protein
Species
Emericella nidulans (Aspergillus nidulans)
Target Names
nd3
Target Protein Sequence
MTTTTFFLFLIPVLAIILLAVNLIFSPHNPYQEKDSAFECGFHSFLGQNRTQFSISFFIF ALLFLLFDLEILLVYPYVVSAYTNGIYGLVIMLVFFLVGTLGFAFELGKNALKIESRQVY NFNYKSWSGYSLIYNK
Uniprot No.
P15956

Target Background

Function
A core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), this protein is considered part of the minimal assembly required for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the enzyme's immediate electron acceptor.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.