Recombinant Emericella nidulans NADH-ubiquinone oxidoreductase chain 4 (nd4)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondrial Complex I

As a subunit of NADH-ubiquinone oxidoreductase (Complex I), nd4 facilitates the transfer of electrons from NADH to ubiquinone during oxidative phosphorylation . This process generates a proton gradient across the mitochondrial inner membrane, driving ATP synthesis. Key functional attributes include:

  • Catalytic Activity: Binds ubiquinone and participates in redox-coupled proton translocation .

  • Structural Role: Essential for Complex I assembly and stability .

  • Conservation: Shares homology with human MT-ND4, which is implicated in neurodegenerative diseases like Leber hereditary optic neuropathy .

Research and Production Insights

Producing recombinant nd4 in E. nidulans presents challenges due to cellular stress responses. Proteomic studies of A. nidulans recombinant strains reveal upregulated energy metabolism and endoplasmic reticulum pathways during heterologous protein expression . For nd4 specifically:

  • Yield Optimization: Requires codon optimization and chaperone co-expression to mitigate misfolding .

  • Stability: Repeated freeze-thaw cycles degrade activity; glycerol stabilizes the protein during storage .

Applications in Research

  • Enzyme Kinetics: Used to study Complex I inhibition by rotenone or annonacin .

  • Structural Biology: Purified nd4 aids in cryo-EM studies to resolve Complex I architecture .

  • Disease Modeling: Serves as a prokaryotic model for mitochondrial dysfunction linked to Parkinson’s disease .

Comparative Analysis with Orthologs

Recombinant nd4 variants across species exhibit functional conservation but differ in sequence length and host compatibility :

SpeciesProtein LengthHost SystemTag
Emericella nidulans221 aaE. coliHis
Anopheles arabiensis221 aaE. coliHis
Artemia salina71 aaE. coliHis

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
nd4; ndhD; NADH-ubiquinone oxidoreductase chain 4; NADH dehydrogenase subunit 4; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-221
Protein Length
full length protein
Species
Emericella nidulans (Aspergillus nidulans)
Target Names
nd4
Target Protein Sequence
ASINYTYIIYVIGVITILYASFSTLRTIDIKELIAYSSVSHAAVYLIGAFSNTIQGIEGS IALGLAHGFVSSGLFICAGGILYDRSSTRLITYYRGMAQIMPIFSVLFFILALGNSGTPL TLNFIGEFMSLYGVFERMPILGVLASTSIVFSAAYTIFMYNRIVFGGSYSIYFRENIGDV TRREFIMLLVFVILTVLFGIYPAPILDGLHYSVSYLIYNIN
Uniprot No.

Target Background

Function
This protein is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed to be part of the minimal assembly required for catalysis. Complex I facilitates the transfer of electrons from NADH to the respiratory chain. The enzyme's immediate electron acceptor is thought to be ubiquinone.
Protein Families
Complex I subunit 4 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is NADH-ubiquinone oxidoreductase chain 4 (nd4) and what is its role in Emericella nidulans?

NADH-ubiquinone oxidoreductase chain 4 (nd4) is a mitochondrial protein component of Complex I in the electron transport chain. In Emericella nidulans (the sexual state designation of Aspergillus nidulans), this protein plays a crucial role in energy metabolism and cellular respiration. The protein consists of 221 amino acids and functions as part of the membrane-embedded domain of the NADH dehydrogenase complex, facilitating electron transfer and proton translocation across the inner mitochondrial membrane .

How does Emericella nidulans nd4 compare to homologous proteins in other fungal species?

Emericella nidulans nd4 shares significant sequence homology with NADH dehydrogenase subunit 4 proteins from other filamentous fungi, particularly within the Aspergillus genus. While the core functional domains are generally conserved across species, there are variations in specific amino acid residues that may confer species-specific characteristics. The protein in E. nidulans contains signature sequence motifs consistent with its role in proton pumping and electron transfer, similar to other fungal mitochondrial encoded nd4 proteins . Comparative analysis of these homologs can provide insights into evolutionary adaptation of energy metabolism pathways in different fungal lineages.

What are the optimal conditions for reconstitution of lyophilized recombinant Emericella nidulans nd4 protein?

For optimal reconstitution of lyophilized recombinant E. nidulans nd4 protein:

  • Briefly centrifuge the vial containing lyophilized protein to ensure all content settles at the bottom.

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% (50% is recommended for optimal stability).

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles.

  • Store aliquots at -20°C/-80°C for long-term storage.

The reconstituted protein should be maintained in Tris/PBS-based buffer with 6% trehalose at pH 8.0 to preserve its stability and functionality. Working aliquots can be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they can compromise protein integrity .

What purification strategies are most effective for isolating functional recombinant nd4 protein for structural studies?

For isolating functional recombinant nd4 protein with high purity for structural studies:

  • Initial Affinity Chromatography: Utilize the N-terminal His-tag for immobilized metal affinity chromatography (IMAC), preferably using Ni-NTA resin under native conditions.

  • Detergent Selection: Incorporate appropriate detergents (such as n-dodecyl β-D-maltoside or digitonin) in buffers to maintain the native conformation of this highly hydrophobic membrane protein.

  • Size Exclusion Chromatography: Follow IMAC with gel filtration to separate aggregates and achieve >95% purity.

  • Gradient Elution: Implement a shallow imidazole gradient during IMAC to minimize co-elution of contaminants.

  • Buffer Optimization: Maintain pH between 7.5-8.0 with stabilizing agents such as trehalose.

For structural studies, the final protein preparation should achieve purity greater than 90% as determined by SDS-PAGE, with minimal aggregation and preserved secondary structure . Circular dichroism spectroscopy can be employed to verify proper protein folding before proceeding to crystallization or cryo-EM studies.

How can researchers design experiments to study the interaction between recombinant nd4 and other components of the respiratory chain?

To study interactions between recombinant nd4 and other respiratory chain components:

  • Co-immunoprecipitation Assays: Use antibodies against the His-tag of recombinant nd4 to pull down interacting partners from mitochondrial extracts.

  • Biolayer Interferometry: Immobilize purified nd4 on biosensors to measure binding kinetics with purified respiratory chain components.

  • Cross-linking Studies: Employ chemical cross-linkers of varying lengths to capture transient protein-protein interactions within the complex.

  • Reconstitution in Liposomes: Create proteoliposomes containing nd4 and potential interacting partners to study functional interactions in a membrane environment.

  • FRET Analysis: Generate fluorescently labeled protein variants to monitor proximity and conformational changes during interactions.

These approaches should be complemented with functional assays measuring electron transfer or proton translocation to correlate physical interactions with functional outcomes. Control experiments with mutated proteins or in the presence of specific inhibitors will help validate the specificity of observed interactions .

How can heterologous expression systems be optimized for producing functional Emericella nidulans nd4 protein?

Optimizing heterologous expression of functional E. nidulans nd4 requires addressing several challenges inherent to membrane proteins:

  • Expression Host Selection: E. coli is commonly used, but for improved folding and post-translational modifications, consider Pichia pastoris or insect cell systems.

  • Codon Optimization: Adapt the coding sequence to the preferred codon usage of the host organism while maintaining critical structural elements.

  • Fusion Partners: Beyond the standard His-tag, incorporate fusion partners like MBP or SUMO that enhance solubility and proper membrane insertion.

  • Induction Parameters: For E. coli systems, low temperature induction (16-20°C) with reduced IPTG concentrations (0.1-0.5 mM) often improves folding of membrane proteins.

  • Membrane Mimetics: Include specific phospholipids or detergents in the growth medium to facilitate proper membrane insertion.

Expression can be verified by Western blotting using antibodies against the His-tag, while functionality can be assessed through activity assays measuring NADH oxidation coupled to ubiquinone reduction. Protein quality should be evaluated by circular dichroism and thermal shift assays to ensure proper folding .

What methodologies can be employed to study the role of nd4 in mitochondrial dysfunction models?

To investigate nd4's role in mitochondrial dysfunction:

  • CRISPR/Cas9 Gene Editing: Generate point mutations in nd4 that mimic those associated with mitochondrial disorders in higher organisms.

  • Respiration Measurements: Use high-resolution respirometry to assess oxygen consumption rates in mitochondria with wild-type versus mutant nd4.

  • ROS Production Assays: Quantify reactive oxygen species generation using fluorescent probes to determine if nd4 mutations alter electron leakage.

  • Membrane Potential Analysis: Employ potentiometric dyes to measure changes in mitochondrial membrane potential associated with nd4 variants.

  • Metabolomic Profiling: Conduct comprehensive analysis of metabolite changes in response to nd4 dysfunction.

These approaches can be applied in reconstituted systems as well as in fungal models where the native nd4 has been replaced with mutant versions. Correlation between biochemical defects and phenotypic changes will provide insights into the pathophysiology of mitochondrial disorders related to Complex I dysfunction .

How can structure-function relationship studies of nd4 contribute to understanding proton pumping mechanisms in Complex I?

Structure-function studies of nd4 can illuminate proton pumping mechanisms through:

  • Site-Directed Mutagenesis: Systematically alter conserved residues in predicted proton translocation pathways to identify essential amino acids.

  • Hydrogen-Deuterium Exchange Mass Spectrometry: Map conformational dynamics and solvent accessibility changes during the catalytic cycle.

  • Computational Molecular Dynamics: Simulate proton movement through potential channels in nd4 based on structural data.

  • Nanodiscs Reconstitution: Incorporate purified nd4 into nanodiscs with defined lipid composition to study how membrane environment influences function.

  • Electrophysiological Measurements: Develop proteoliposome-based systems for direct measurement of proton translocation.

By integrating these approaches, researchers can develop mechanistic models describing how electron transfer through the peripheral arm of Complex I is coupled to proton pumping through membrane-embedded subunits like nd4. Such studies can reveal conserved mechanisms across species and identify potential targets for therapeutic intervention in mitochondrial disorders .

What are common challenges in obtaining high-quality recombinant Emericella nidulans nd4 protein and how can they be addressed?

ChallengeCauseSolution
Low expression yieldProtein toxicity to host cells; codon biasUse tightly regulated expression systems; optimize codons; lower induction temperature to 16-18°C
Protein aggregationImproper folding; hydrophobic interactionsInclude appropriate detergents (0.1-1% DDM); consider fusion with solubility-enhancing tags
Degradation during purificationProteolytic activity; protein instabilityAdd protease inhibitors; maintain samples at 4°C; reduce purification time
Loss of activity after purificationCofactor loss; denaturationSupplement buffers with stabilizing agents; verify proper folding by CD spectroscopy
Batch-to-batch variabilityInconsistent expression conditionsStandardize all parameters from culture growth to final storage; implement quality control metrics

Implementing a systematic optimization approach that addresses each stage of production and purification can significantly improve recombinant protein quality. Monitor protein integrity throughout the process using analytical techniques such as SDS-PAGE, Western blotting, and activity assays .

How should researchers interpret contradictory data when studying nd4 interactions with inhibitors and substrates?

When encountering contradictory data in nd4 inhibitor/substrate studies:

  • Examine Protein Quality: Verify protein integrity through multiple methods (SDS-PAGE, mass spectrometry) to ensure observations aren't due to degradation or aggregation.

  • Consider Methodological Differences: Compare experimental conditions including buffer composition, pH, temperature, and detergent concentration that could affect interaction kinetics.

  • Assess Binding Site Accessibility: Evaluate whether the recombinant protein's conformation provides appropriate access to binding sites compared to the native complex.

  • Implement Orthogonal Approaches: Apply multiple techniques (thermal shift assays, microscale thermophoresis, isothermal titration calorimetry) to validate interactions.

  • Contextual Analysis: Consider whether the isolated nd4 behavior differs from its function within the complete Complex I structure.

Resolution often requires systematic variation of experimental parameters to identify conditions where results converge. In cases where contradictions persist, computational modeling may provide hypotheses about conditional dependencies of interactions that can be experimentally tested .

What statistical approaches are most appropriate for analyzing enzymatic activity data from recombinant nd4 studies?

For rigorous analysis of enzymatic activity data from recombinant nd4 studies:

  • Enzyme Kinetics Modeling: Apply Michaelis-Menten or allosteric models as appropriate, using non-linear regression rather than linearization methods for parameter estimation.

  • Outlier Analysis: Implement robust statistical methods (e.g., modified Z-score) to identify and appropriately handle outliers without arbitrary exclusion.

  • Multiple Comparisons Correction: When testing multiple conditions or inhibitors, apply Bonferroni or false discovery rate corrections to avoid Type I errors.

  • Mixed-Effects Models: For experiments with multiple batches or preparations, use mixed-effects models to account for batch variability while testing treatment effects.

  • Power Analysis: Conduct a priori power calculations to determine appropriate sample sizes for detecting biologically meaningful differences in activity.

Data should be visualized using approaches that represent both the central tendency and dispersion of measurements. For complex experiments with multiple factors, factorial design analysis can reveal interaction effects between variables that might be missed in single-factor experiments .

How does research on recombinant nd4 from Emericella nidulans relate to studies on mitochondrial diseases in humans?

Research on E. nidulans nd4 provides valuable insights for human mitochondrial disease studies through several connections:

  • Conserved Structural Elements: The core structural domains of nd4 are evolutionarily conserved from fungi to humans, allowing fundamental mechanistic insights to be translated across species.

  • Disease-Associated Mutations: Many pathogenic mutations in human ND4 occur in regions with fungal homology, enabling the creation of model systems in E. nidulans to study pathophysiology.

  • Drug Development Platform: The fungal system offers a simplified platform for screening potential therapeutics targeting Complex I dysfunction before advancing to more complex models.

  • Bypass Mechanism Identification: Studies in fungi have revealed alternative metabolic pathways that can compensate for Complex I deficiency, suggesting therapeutic approaches for mitochondrial disorders.

  • Heteroplasmy Effects: Fungal models can be engineered to contain mixed populations of mitochondria, mimicking heteroplasmy conditions seen in human mitochondrial diseases.

By establishing structure-function relationships in the fungal protein, researchers can make predictions about the consequences of mutations in the human homolog, prioritizing candidates for further investigation using more complex models .

What bioinformatic approaches can help identify functional domains and critical residues in nd4 for targeted mutagenesis studies?

Advanced bioinformatic approaches for identifying functional domains in nd4 include:

  • Multiple Sequence Alignment: Compare nd4 sequences across diverse species to identify conserved regions likely to be functionally important, with special attention to conservation patterns between fungal and mammalian homologs.

  • Hydropathy Analysis: Use algorithms such as TMHMM or Phobius to predict transmembrane segments, which can be correlated with proton translocation pathways.

  • Evolutionary Rate Analysis: Calculate site-specific evolutionary rates to identify positions under selective pressure that may have functional significance.

  • Coevolution Analysis: Implement statistical coupling analysis to detect residues that show coordinated evolution, suggesting functional or structural interactions.

  • Molecular Dynamics Simulations: Use homology models in MD simulations to predict conformational changes and identify residues involved in gating mechanisms.

These approaches can be integrated to create a prioritized list of residues for targeted mutagenesis, focusing on those likely to affect proton pumping, ubiquinone binding, or subunit interactions. Visualization tools can map this information onto structural models to guide experimental design .

How can knowledge gained from studying the emericellamide biosynthetic pathway in Aspergillus nidulans be applied to research on mitochondrial proteins like nd4?

The research approaches used to elucidate the emericellamide biosynthetic pathway provide valuable methodological frameworks applicable to nd4 research:

  • Genomic Cluster Analysis: Similar to the identification of the eas cluster, researchers can analyze genomic regions surrounding nd4 to identify functionally related genes involved in Complex I assembly or regulation.

  • Gene Deletion Strategies: The efficient gene deletion approach demonstrated in emericellamide research can be applied to create clean knockouts of nd4 and interacting proteins to study their roles in mitochondrial function.

  • Promoter Replacement: As suggested for emericellamide genes, native promoters of nd4 can be replaced with inducible or strong constitutive promoters to increase protein expression for structural studies.

  • Heterologous Expression: The experiences gained in expressing fungal biosynthetic enzymes can inform strategies for successful expression of nd4 in heterologous systems.

  • Metabolic Profiling: Similar to the analysis of emericellamide derivatives, metabolomic approaches can track changes in cellular metabolism resulting from nd4 mutations or inhibition.

The integrative approach combining genetic manipulation, protein biochemistry, and analytical chemistry used in the emericellamide research provides a powerful template for comprehensive investigation of mitochondrial proteins like nd4 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.