Recombinant Emericella nidulans Palmitoyltransferase erf2 (erf2)

Shipped with Ice Packs
In Stock

Description

Functional Role in Protein Palmitoylation

Erf2 functions as a Ras protein acyltransferase (PAT) in complex with its regulatory subunit Erf4. Key mechanistic insights include:

  • Catalytic Mechanism:

    • Erf2 undergoes autopalmitoylation at the DHHC motif, forming a palmitoyl-thioester intermediate .

    • This intermediate transfers palmitate to substrate proteins (e.g., Ras GTPases) via a two-step reaction .

  • Dependence on Erf4:

    • Erf4 stabilizes Erf2 by preventing ubiquitin-mediated degradation through the ER-associated degradation (ERAD) pathway .

    • Erf4 enhances the stability of the palmitoyl-Erf2 intermediate, reducing futile hydrolysis and increasing substrate palmitoylation efficiency .

Key Studies:

  1. Erf2-Erf4 Complex Dynamics:

    • In Saccharomyces cerevisiae, Erf4-deficient strains show reduced Erf2 stability and compromised Ras palmitoylation, highlighting Erf4's role in enzyme regulation .

    • Mammalian homologs (DHHC9-GCP16) exhibit analogous dependency, suggesting evolutionary conservation of this regulatory mechanism .

  2. Biotechnological Relevance:

    • Recombinant Erf2 is used to study fungal lipid metabolism and palmitoylation-dependent signaling pathways.

    • Its role in Ras localization makes it a potential target for antifungal therapies or cancer research .

Comparative Analysis with Other Systems

FeatureE. nidulans Erf2-Erf4Mammalian DHHC9-GCP16
Subunit RequirementErf4 stabilizes Erf2 and enhances catalysisGCP16 required for DHHC9 activity
Substrate SpecificityRas proteinsRas and other membrane proteins
Regulatory PathwayERAD-mediated degradation without Erf4Not fully characterized

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
The shelf life is influenced by multiple factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize developing your specified tag.
Synonyms
erf2; AN4763; Palmitoyltransferase erf2; DHHC cysteine-rich domain-containing protein erf2; Ras protein acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-601
Protein Length
full length protein
Species
Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)
Target Names
erf2
Target Protein Sequence
MAFQFSNNPESNETTNNPAPHVLGLPRPPSVGGISSRVTDMSEDGDQSQTNTMSSHVPHR HSVSRRGPPPARSSIASTSQITNRPGSSASRLSRTHIPSLAASGFFRPMSSQRLQAHRGR PATNHTVSTEDWGDQMNQNRRSLISNSTFPNSLSAADQEVPPSRGTEFTDPIIPDRIHSN ASPTANTTTVRSESANLIRDRERPPHLNLKVDYKGTNENETPERSPLSFLSLQNRNAPAD NRDSRAHARLSSADSSPQSIEKKPELAKSRNKGRNYEYFVGNTIFLGGGRFQNSRDKPVN IATGLLVLVPTGLFFGFSGPWLWHNISPAIPVLFAYVFYLCFSSFIHASVVDPGVIPRNL HQMPPVDPSQDPLAIGPPTNDWVMVKLATSDVAAMDVPVKYCKTCSIWRPPRCYHCRVCD NCIETLDHHCVWLNNCVGRRNYRYFFAFVSTSTLLALFLLGASLAHILVYRSREGISFSD AIDKWRVPFAMVIYGALAAPYPASLWAYHLFLVGRGETTREYLNSHKFAKADRHRPFTQG NVIRNWIAVFGRPRPPTYMQFKEYYQEGDQRLSTVKRRFLPRNTEPQNDIEMQHVPPPNS A
Uniprot No.

Target Background

Function
Palmitoyltransferase specific for Ras proteins.
Database Links

KEGG: ani:AN4763.2

Protein Families
DHHC palmitoyltransferase family, ERF2/ZDHHC9 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Emericella nidulans and how does it relate to Aspergillus nidulans?

Emericella is the genus designation generally used for species of Aspergillus with a demonstrated sexual cycle. Therefore, Emericella nidulans and Aspergillus nidulans refer to the same organism at different stages of its life cycle. Aspergillus/Emericella nidulans serves as an established laboratory model fungus with a fully sequenced genome, making it ideal for genetic studies of various cellular processes including protein modifications like S-acylation . Its genome has revealed potential to produce a surprisingly large range of natural products, many of which were previously unknown . The relationship between these nomenclatures is important to understand when reviewing literature, as publications may use either name depending on which aspect of the organism's biology they're investigating.

What are palmitoyltransferases (PATs) and what is their functional significance?

Palmitoyltransferases (PATs) are enzymes that catalyze S-acylation (commonly known as palmitoylation), a widespread post-translational modification involving the addition of a lipid molecule to cysteine residues of a protein through a thioester bond . Most PATs are polytopic membrane proteins with four to six transmembrane domains and a conserved DHHC motif . They also contain variable C- and N-terminal regions that likely confer localization and substrate specificity . In fungi like Emericella nidulans, PATs including erf2 play crucial roles in various cellular processes by regulating protein localization, stability, and function through the addition of lipid moieties. This modification affects protein-protein interactions, membrane association, and trafficking, which are essential for cellular signaling and metabolism.

What is the PaCCT motif and why is it essential for palmitoyltransferase function?

The PaCCT (Palmitoyltransferase Conserved C-Terminus) motif is a novel 16-amino-acid sequence present at the cytosolic C-terminus of palmitoyltransferases that is required for their function . This motif was discovered through studies of yeast PATs like Swf1 and Pfa3, and is also present in other yeast PATs such as Pfa5 and Erf2 . Within this motif, specific residues like Tyr 323 in Swf1 have been identified as essential for function, and mutations in these residues affect the enzyme's ability to palmitoylate its substrates . The PaCCT motif is conserved in approximately 70% of PATs from all eukaryotic organisms analyzed, suggesting a universal functional importance . Mutations in this region represent the first phenotype-affecting mutations uncovered outside the DHHC domain for PATs, highlighting its significance for enzymatic activity and substrate recognition .

What are the optimal methods for expressing recombinant Erf2 from Emericella nidulans?

For successful expression of recombinant Erf2 from Emericella nidulans, researchers should consider several methodological approaches based on its membrane-associated nature and structural features. A recommended protocol begins with gene amplification using PCR with primers that include appropriate restriction sites and epitope tags. When designing the expression construct, it's crucial to consider the presence of the PaCCT motif at the C-terminus, as this 16-amino-acid sequence is essential for function . For expression systems, both bacterial (E. coli) and eukaryotic (yeast or insect cells) options can be considered, though eukaryotic systems often yield better results for membrane proteins.

For E. coli expression, strain BL21(DE3) with pET vectors containing a 6xHis-tag can be used, with expression typically induced at lower temperatures (16-18°C) to enhance protein folding. For yeast expression, Pichia pastoris or Saccharomyces cerevisiae systems with inducible promoters may preserve the native conformation better than bacterial systems. Expression should be verified using SDS-PAGE and Western blotting with antibodies against the epitope tag or Erf2 itself. Since Erf2 is a membrane protein with multiple transmembrane domains, special consideration must be given to solubilization using appropriate detergents such as n-dodecyl β-D-maltoside (DDM) or digitonin.

How can the enzymatic activity of recombinant Erf2 be measured in vitro?

To measure the enzymatic activity of recombinant Erf2 in vitro, researchers should employ assays that detect the transfer of lipid moieties to substrate proteins. A commonly used approach involves radiolabeled palmitoyl-CoA as a donor and known substrate proteins. The assay typically includes recombinant purified Erf2, buffer conditions (usually pH 7.2-7.4), magnesium or manganese ions as cofactors, reducing agents like DTT, and the substrate protein.

The reaction mixture containing purified Erf2, [³H]-palmitoyl-CoA (or other labeled acyl-CoA), and substrate protein is incubated at 30°C for 30-60 minutes. The reaction is stopped by adding SDS sample buffer, and proteins are separated by SDS-PAGE. The incorporation of radioactive palmitate into substrate proteins can then be detected by fluorography or scintillation counting of gel slices. Alternatively, non-radioactive methods using click chemistry can be employed, where alkyne-tagged palmitic acid analogs are used as donors, followed by conjugation to fluorescent azide reporters.

For control experiments, researchers should include:

  • Reactions without enzyme

  • Reactions with heat-inactivated enzyme

  • Reactions with Erf2 containing mutations in the DHHC catalytic domain

  • Reactions with Erf2 containing mutations in the PaCCT motif, which has been shown to be essential for PAT function

What genetic techniques can be used to study Erf2 function in Emericella nidulans?

Several genetic approaches can be employed to study Erf2 function in Emericella nidulans, leveraging the organism's established genetic tools and sexual cycle. Gene deletion strategies are particularly effective, as demonstrated in the study of emericellamide biosynthesis where multiple genes were systematically deleted to identify pathway components . For Erf2 specifically, researchers can use homologous recombination-based gene targeting techniques to generate knockout strains.

A recommended workflow includes:

  • Creating gene deletion constructs containing selectable markers (e.g., pyrG, pyroA) flanked by 1-2kb sequences homologous to regions upstream and downstream of the erf2 gene

  • Transforming Emericella nidulans protoplasts with these constructs

  • Selecting transformants on appropriate media lacking uridine/uracil (for pyrG marker) or pyridoxine (for pyroA marker)

  • Confirming gene deletion by PCR and Southern blotting

  • Phenotypic characterization of the mutants through morphological analysis, growth assays, and metabolite profiling

For more sophisticated analyses, researchers can employ:

  • Site-directed mutagenesis to create specific mutations in the DHHC domain or PaCCT motif

  • GFP tagging for localization studies

  • Conditional expression systems using regulatable promoters like alcA

  • Complementation assays to confirm phenotype attribution

  • RNA-seq to identify genes with altered expression in erf2 mutants

How can potential substrates of Erf2 be identified in Emericella nidulans?

Identifying potential substrates of Erf2 in Emericella nidulans requires a multi-faceted approach combining computational prediction, proteomics, and validation experiments. A comprehensive substrate identification strategy should include:

  • Bioinformatic prediction: Analyze the E. nidulans proteome for proteins containing potential palmitoylation sites (typically cysteines in the context of transmembrane domains or membrane-proximal regions). Tools like CSS-Palm or NBA-Palm can assist in this prediction.

  • Comparative proteomics: Compare wild-type and erf2-deletion strains using acyl-biotin exchange (ABE) or acyl-resin-assisted capture (Acyl-RAC) methods. These techniques involve:

    • Blocking free thiols with N-ethylmaleimide

    • Cleaving thioester bonds with hydroxylamine

    • Capturing newly exposed thiols with biotin-HPDP

    • Enriching biotinylated proteins with streptavidin

    • Identifying proteins by mass spectrometry

  • Metabolic labeling: Treat fungal cultures with alkyne-tagged palmitic acid analogs (17-ODYA), followed by click chemistry conjugation to azide-containing reporters for visualization or enrichment of palmitoylated proteins.

  • Validation experiments: Confirm direct palmitoylation by Erf2 through in vitro assays using recombinant Erf2 and candidate substrates. Focus particularly on proteins involved in vesicular trafficking, membrane fusion, and signal transduction, as these are common functions for palmitoylated proteins.

  • Functional confirmation: Analyze phenotypic effects of mutating palmitoylation sites in identified substrates, looking for phenocopying of erf2 deletion effects.

What role does the PaCCT motif play in substrate recognition by Erf2?

The PaCCT (Palmitoyltransferase Conserved C-Terminus) motif is a critical functional element of palmitoyltransferases including Erf2. Research has demonstrated that this 16-amino-acid sequence at the cytosolic C-terminus is essential for PAT function . Within this motif, specific residues have been identified as crucial - for example, Tyr 323 in the yeast PAT Swf1, with equivalent mutations in other PATs including Pfa3 also affecting their function .

The PaCCT motif likely contributes to substrate recognition through several potential mechanisms:

  • Direct substrate binding: The motif may form part of a substrate recognition surface that directly interacts with target proteins. The conservation of specific residues suggests precise structural requirements for this interaction.

  • Conformational regulation: The PaCCT motif might regulate the conformation of the DHHC catalytic domain, influencing its accessibility to substrates or its catalytic efficiency.

  • Protein-protein interactions: The motif could mediate interactions with adapter proteins that facilitate substrate recruitment or positioning relative to the catalytic site.

  • Membrane positioning: By influencing the orientation of the enzyme within the membrane, the PaCCT motif might optimize the positioning of the catalytic domain relative to substrate cysteine residues.

Mutations in the PaCCT motif have been correlated with lack of palmitoylation of known substrates, such as the SNARE protein Tlg1 in the case of Swf1 . This suggests that the motif is not merely important for protein stability or localization, but directly impacts catalytic function or substrate recognition.

How does Erf2 function compare between Emericella nidulans and other fungal species?

Comparative analysis of Erf2 function across fungal species reveals both conserved mechanisms and species-specific adaptations. The PAT family, including Erf2, demonstrates considerable evolutionary conservation, with the PaCCT motif being present in approximately 70% of PATs from all eukaryotic organisms analyzed . This conservation suggests fundamental functional importance.

In comparing Erf2 across fungal species:

  • Structural conservation: The core DHHC domain and PaCCT motif show high sequence conservation. For instance, the PaCCT motif is present in PATs from diverse fungi including Saccharomyces cerevisiae, Schizosaccharomyces pombe, and Emericella species .

  • Substrate specificity: While the enzymatic mechanism is conserved, substrate preferences may differ between species. This variation likely reflects the different proteomes and cellular processes in different fungi.

  • Cellular localization: Erf2 localization patterns may vary between fungal species, reflecting differences in endomembrane organization and specialized compartments.

  • Functional redundancy: The number of PAT enzymes varies between fungal species, affecting the degree of functional specialization or redundancy. Model organisms like S. cerevisiae have seven PATs, while filamentous fungi like E. nidulans may have a different complement.

  • Physiological roles: In different fungi, Erf2 may be recruited for species-specific functions. For instance, in pathogenic fungi, Erf2 might regulate virulence factors, while in saprophytic species it might be more involved in nutrient acquisition pathways.

Research comparing PAT function between S. cerevisiae and other fungi has identified both overlapping and distinct roles. Similar comparative studies with E. nidulans Erf2 would provide valuable insights into the evolution and specialization of this enzyme family.

What role might Erf2 play in the biosynthesis of secondary metabolites in Emericella nidulans?

Emericella nidulans produces a diverse array of secondary metabolites, including the recently discovered emericellamides, which are mixed polyketide-nonribosomal peptide compounds with antibiotic properties . While no direct evidence links Erf2 to secondary metabolite biosynthesis in the provided search results, several mechanistic hypotheses can be proposed based on known PAT functions and secondary metabolite pathways.

Potential roles for Erf2 in secondary metabolism include:

  • Regulation of biosynthetic enzymes: Erf2 may palmitoylate enzymes involved in secondary metabolite biosynthesis, affecting their localization, stability, or activity. For example, the emericellamide biosynthetic pathway involves both a polyketide synthase (PKS) and a nonribosomal peptide synthetase (NRPS) , which could potentially be regulated by post-translational modifications.

  • Transport of pathway intermediates: Many secondary metabolite pathways involve multiple enzymes localized to different cellular compartments. Erf2 might palmitoylate transport proteins that shuttle intermediates between these compartments.

  • Secretion of final products: The export of completed secondary metabolites often requires specialized transporters. Palmitoylation by Erf2 could regulate these transporters, affecting metabolite secretion and accumulation.

  • Environmental sensing: Palmitoylation can modulate signaling pathways that respond to environmental cues. Erf2 might therefore influence the activation of secondary metabolite biosynthesis in response to specific conditions.

To investigate these potential roles, researchers could:

  • Compare secondary metabolite profiles between wild-type and erf2-deletion strains

  • Analyze the palmitoylation status of known secondary metabolite biosynthetic enzymes

  • Examine the localization of fluorescently tagged biosynthetic enzymes in erf2 mutants

  • Test the effects of erf2 overexpression on metabolite production

How do mutations in the PaCCT motif affect Erf2 function and substrate specificity?

Mutations in the PaCCT motif have profound effects on palmitoyltransferase function, as demonstrated by studies on related PATs. Research has shown that within this 16-amino-acid motif, single residue mutations can abolish enzyme activity. For example, in the yeast PAT Swf1, mutation of Tyr 323 resulted in loss of function that correlated with lack of palmitoylation of its substrate Tlg1 . Equivalent mutations in other PATs, such as Pfa3, similarly affected their function .

The effects of PaCCT motif mutations on Erf2 function and substrate specificity likely include:

  • Complete loss of function: Mutations of critical residues may render the enzyme completely inactive, preventing palmitoylation of all substrates.

  • Substrate-selective effects: Some mutations might differentially affect palmitoylation of various substrates, revealing substrate-specific interaction regions within the motif.

  • Altered kinetics: Certain mutations may not abolish activity but could reduce catalytic efficiency, resulting in reduced palmitoylation rates for substrates.

  • Altered localization: The PaCCT motif might influence enzyme localization within cellular compartments, with mutations potentially disrupting proper targeting.

A systematic approach to studying PaCCT motif mutations in Erf2 would involve:

Mutation TypeExperimental ApproachExpected OutcomeControl/Validation
Alanine scanningSite-directed mutagenesis of each residue in the motifIdentification of essential residuesWild-type enzyme as positive control
Conservative substitutionsReplace key residues with similar amino acidsDetermine chemical requirements for functionComparison with non-conservative substitutions
Chimeric constructsSwap PaCCT motifs between different PATsTest motif interchangeabilityAnalysis of substrate specificity changes
TruncationsRemove portions of the C-terminusDefine minimal functional regionComplementation with full-length gene
Domain swappingExchange domains between PATsMap determinants of substrate specificityIn vitro assays with known substrates

What are common challenges in expressing recombinant fungal palmitoyltransferases?

Expressing recombinant fungal palmitoyltransferases presents several challenges due to their hydrophobic nature and multiple transmembrane domains. Common issues include:

  • Protein misfolding and aggregation: As membrane proteins with multiple transmembrane segments, PATs like Erf2 often misfold when overexpressed, forming insoluble aggregates. This is particularly problematic in bacterial expression systems that lack appropriate membrane insertion machinery.

  • Toxicity to host cells: Overexpression of membrane proteins can disrupt host cell membrane integrity, leading to growth inhibition or cell death, especially in bacterial hosts.

  • Low expression yields: Even when successfully expressed, the yields of functional PATs are often low compared to soluble proteins.

  • Post-translational modifications: Fungal PATs may require specific post-translational modifications for activity that are not properly executed in heterologous expression systems.

  • Protein stability: Once purified, maintaining the stability and activity of PATs is challenging due to their dependence on a lipid environment.

To address these challenges, researchers should consider the following strategies:

  • Use eukaryotic expression systems (yeast, insect cells) that better accommodate membrane protein expression

  • Express the protein as fragments excluding transmembrane domains, focusing on catalytic regions

  • Utilize fusion partners that enhance solubility (e.g., MBP, SUMO, GST)

  • Optimize induction conditions (lower temperature, reduced inducer concentration)

  • Include appropriate detergents during extraction and purification

  • Consider nanodiscs or liposomes for maintaining activity after purification

  • Use chemical chaperones during expression to improve folding

Special attention should be paid to preserving the integrity of the PaCCT motif, as this C-terminal region is essential for function .

How can substrate specificity of Erf2 be determined experimentally?

Determining the substrate specificity of Erf2 requires a comprehensive experimental approach combining in vitro biochemical assays with in vivo validation. The following methodological framework provides a systematic strategy:

  • In vitro palmitoylation assays:

    • Express and purify recombinant Erf2 maintaining the integrity of both the DHHC domain and PaCCT motif

    • Prepare a panel of potential substrate proteins or peptides containing candidate palmitoylation sites

    • Conduct palmitoylation reactions using radiolabeled [³H]-palmitoyl-CoA or bio-orthogonal analogs

    • Measure incorporation rates for different substrates to establish kinetic parameters (Km, Vmax)

    • Compare wild-type Erf2 with mutants affecting the DHHC domain or PaCCT motif

  • Substrate competition assays:

    • Perform reactions with multiple substrates simultaneously to assess preferential palmitoylation

    • Use varying substrate concentrations to determine competitive inhibition patterns

    • Derive binding affinities through competitive displacement curves

  • Structural determinants of specificity:

    • Create chimeric substrates combining regions from good and poor substrates

    • Perform alanine-scanning mutagenesis of substrate palmitoylation sites and surrounding regions

    • Develop peptide arrays with systematic variations to map recognition elements

  • In vivo validation:

    • Generate Emericella nidulans strains expressing mutant versions of identified substrates

    • Compare palmitoylation levels of wild-type and mutant substrates in normal and erf2-deletion backgrounds

    • Assess functional consequences of preventing palmitoylation of specific substrates

  • Global profiling:

    • Compare the palmitoylated proteome between wild-type and erf2-deletion strains

    • Identify differentially palmitoylated proteins using quantitative proteomics

    • Validate direct Erf2 dependence through complementation with wild-type and catalytically inactive Erf2

This experimental framework provides a comprehensive approach to defining both the direct substrates of Erf2 and the structural features that determine substrate recognition, building on established methodologies from studies of other palmitoyltransferases including those containing the essential PaCCT motif .

How can advanced imaging techniques be applied to study Erf2 localization and dynamics?

Advanced imaging techniques offer powerful approaches to visualize Erf2 localization, dynamics, and interactions within living fungal cells. Implementing these methods for studying Erf2 in Emericella nidulans requires genetic manipulation to introduce fluorescent tags while preserving the critical functional domains, particularly the PaCCT motif at the C-terminus .

Recommended advanced imaging approaches include:

  • Super-resolution microscopy: Techniques such as Structured Illumination Microscopy (SIM), Stimulated Emission Depletion (STED), and Single-Molecule Localization Microscopy (PALM/STORM) can resolve Erf2 localization beyond the diffraction limit, revealing its precise distribution within membrane compartments. Implementation requires:

    • Creating strains expressing Erf2 fused to photoactivatable or photoswitchable fluorescent proteins

    • Careful sample preparation to minimize autofluorescence from fungal cell walls

    • Image acquisition with specialized microscopes capable of super-resolution

    • Computational reconstruction and analysis of super-resolution datasets

  • Live-cell imaging and dynamics: Tracking Erf2 movement and turnover using:

    • Fluorescence Recovery After Photobleaching (FRAP) to measure protein mobility

    • Photoactivation to track protein movement from specific compartments

    • Single-particle tracking to follow individual Erf2 molecules

    • These approaches can reveal how Erf2 redistributes in response to cellular stresses or developmental cues

  • Interaction studies: Visualizing Erf2 interactions with substrates and other proteins through:

    • Förster Resonance Energy Transfer (FRET) between Erf2 and candidate interaction partners

    • Bimolecular Fluorescence Complementation (BiFC) to trap and visualize transient interactions

    • Proximity Ligation Assays (PLA) for high-sensitivity detection of protein-protein interactions

    • These methods can correlate interactions with specific cellular locations and conditions

  • Correlative Light and Electron Microscopy (CLEM): Combining fluorescence microscopy with electron microscopy to:

    • Precisely localize Erf2 relative to ultrastructural features

    • Visualize membrane topology at sites of Erf2 concentration

    • Map the distribution of Erf2 relative to its substrates and other cellular components

These advanced imaging approaches can address fundamental questions about Erf2 biology, including how its localization relates to substrate accessibility, how its distribution changes during different cellular processes, and how mutations in the PaCCT motif affect its cellular behavior.

What are the potential applications of engineered Erf2 variants with altered substrate specificity?

Engineered Erf2 variants with modified substrate specificity offer exciting possibilities for both fundamental research and biotechnological applications. By altering the substrate recognition properties of this palmitoyltransferase, researchers can develop tools for targeted protein modification and metabolic engineering.

Potential applications and development approaches include:

  • Tools for studying protein function:

    • Engineered Erf2 variants could selectively palmitoylate specific proteins or protein families

    • This would enable researchers to study the functional consequences of palmitoylation on specific targets

    • Such tools could help dissect signaling pathways regulated by protein palmitoylation

  • Metabolic engineering of secondary metabolites:

    • Modified Erf2 enzymes could potentially regulate key enzymes in biosynthetic pathways

    • This might enhance production of valuable compounds such as emericellamides, which have antimicrobial properties

    • Controlled palmitoylation could redirect metabolic flux through desired pathways

  • Synthetic biology applications:

    • Engineered PATs could become components of synthetic signaling networks

    • They could serve as molecular switches to control protein localization in response to specific signals

    • Such systems might enable development of fungal cell factories with inducible production systems

  • Development strategies:

    • Structure-guided mutagenesis targeting the PaCCT motif and other substrate-interacting regions

    • Directed evolution approaches selecting for variants with desired specificities

    • Domain swapping between different PATs to generate chimeric enzymes with novel properties

    • Computational design informed by modeling of enzyme-substrate interactions

  • Validation and characterization:

    • In vitro assays measuring palmitoylation of target and non-target proteins

    • In vivo studies examining effects on cellular processes and metabolite production

    • Proteomic profiling to assess global effects on the palmitoylome

By systematically engineering and characterizing Erf2 variants, researchers can both advance our understanding of the structural determinants of PAT specificity and develop valuable biotechnological tools. The essential role of the PaCCT motif makes it a particularly interesting target for engineering efforts, as modifications to this region might yield variants with predictably altered substrate preferences.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.