Recombinant Emericella nidulans Palmitoyltransferase pfa5 (pfa5)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Emericella nidulans Palmitoyltransferase pfa5 (pfa5) is a bioengineered enzyme derived from the Emericella nidulans fungus. It belongs to the family of DHHC zinc finger-containing palmitoyltransferases, enzymes critical for post-translational protein modifications by transferring palmitoyl groups to cysteine residues, enabling membrane anchoring and modulating signaling pathways . This recombinant protein is produced via heterologous expression systems, primarily for research into lipid metabolism, protein trafficking, and fungal pathogenicity.

Gene Information

The pfa5 gene in E. nidulans is annotated as AN4697.2 or AN4697 . It encodes a partial recombinant protein with the following features:

ParameterDetails
Gene IDAN4697.2; AN4697
Protein ClassPalmitoyltransferase (EC=2.3.1.-)
FunctionProtein fatty acyltransferase; potential role in lipid metabolism
Host SystemsE. coli, yeast, baculovirus, mammalian cells, or cell-free expression
Purity≥85% (confirmed via SDS-PAGE)

Source:

Expression Systems

The recombinant pfa5 is produced in multiple host systems to optimize yield and solubility:

Host SystemAdvantagesLimitations
E. coliHigh yield, cost-effectivePotential misfolding due to prokaryotic environment
YeastEukaryotic post-translational modificationsLower yield compared to bacterial systems
Mammalian CellsNative glycosylation and foldingHigh production costs
Cell-Free ExpressionRapid production, no cellular toxicity issuesLimited scalability for large-scale use

Source:

Purification Methods

Recombinant pfa5 is purified to ≥85% purity using SDS-PAGE validation . Common protocols include:

  • Affinity chromatography: Utilizing tags (e.g., His-tag) for metal-affinity purification.

  • Gel filtration: Size-exclusion chromatography to isolate monomeric forms.

Inferred Functions (Based on Homologs)

PathwayProposed RoleRelated Proteins
Lipid MetabolismPalmitoylation of membrane proteinsDHHC zinc finger proteins (e.g., Pfa5 in Candida)
PathogenicityModulation of fungal virulence factorsAspergillus membrane-associated toxins
Cell SignalingAnchoring signaling proteins to membranesRas, G-protein coupled receptors (GPCRs)

Source:

Research Applications

  1. Protein Palmitoylation Studies: Used to investigate substrate specificity in lipid modification.

  2. Fungal Pathogen Models: Explored in Aspergillus spp. to study virulence mechanisms .

  3. Biotechnological Tools: Serves as a template for engineering lipid-modifying enzymes.

Limitations and Knowledge Gaps

  • Functional Data: Direct experimental evidence for E. nidulans pfa5’s enzymatic activity or substrate targets is absent in public literature.

  • Structural Data: No X-ray crystallography or cryo-EM structures are reported for this recombinant protein.

  • Pathway Interactions: Specific downstream targets or regulatory networks remain uncharacterized.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
pfa5; AN4697; Palmitoyltransferase pfa5; Protein fatty acyltransferase 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)
Target Names
pfa5
Target Protein Sequence
MAGQPDRRINLAVARVIPVVLFGIIIYSCYVITKPLCIDYLIDPLPKYNRPSRVGAGAAI LVVFYILLLFVIITYVRLLYTVVYNPDLLPRSQAADQQSTPAKRSKSRSRRKGHGHGHRK SKSDEVSDKPVSDVERALDYNAGPMVLPWDTAGLEYFYKKDVFVCQPDGRPIYCSKCCHY KPDRTHHCREVDRCVRKMDHFCPWVGGVVSETSFKFFIQFVFYTALFCMTVLIVCAIYTA ELRQDVSLISGSRNMLIISRLVMLTLIGLSDSLQLAAFNLTTIENLNRRSAVWTLAIRVP NHMISRIQPGTRWAPTFRTITYPLPPVPPPLSGMPTQPATGEGDNPYSPPPVPSTDPSAE QHIFAILQTLPGENPFALGSPLKNLQQVLGHSIIDWLLPIKRSPCADHSSAESEFVMGPV VSRLKKEAGLESKDAAAGSITTKHKNSSYNSSPSAPADKRSKRKQKRGKHHHHHHHHRHS STTGTT
Uniprot No.

Target Background

Database Links
Protein Families
DHHC palmitoyltransferase family, PFA5 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Emericella nidulans palmitoyltransferase pfa5 and what is its function in fungal metabolism?

Palmitoyltransferase pfa5 in E. nidulans is hypothesized to function as an acyltransferase involved in the transfer of palmitoyl groups to target substrates within fungal metabolic pathways. Based on current understanding of fungal secondary metabolism, pfa5 likely participates in the biosynthesis of complex lipid-containing metabolites similar to the emericellamide biosynthetic pathway, where acyltransferases play critical roles in shuttling intermediates between enzymatic domains .

In E. nidulans, genes involved in secondary metabolite production are typically clustered, as observed with the emericellamide biosynthetic cluster where an acyltransferase (AN2548.3) mediates the transfer of polyketide intermediates between synthase modules . By analogy, pfa5 may function in a similar biosynthetic context, potentially contributing to the organism's diverse metabolic capabilities that enable adaptation to various environmental conditions .

Methodologically, functional characterization would involve gene deletion studies followed by comparative metabolomic analysis, similar to approaches used for characterizing the emericellamide pathway .

How do I express recombinant E. nidulans pfa5 in a heterologous system?

To express recombinant E. nidulans pfa5, researchers should consider the following methodological approach:

  • Gene identification and cloning: Identify the pfa5 gene sequence from the E. nidulans genome database. Design primers with appropriate restriction sites for subsequent cloning into an expression vector.

  • Expression system selection: For fungal enzymes like pfa5, consider these expression systems:

    • Escherichia coli: Use BL21(DE3) or Rosetta strains with a pET vector system containing a T7 promoter for high-level expression.

    • Pichia pastoris: Consider for improved protein folding and post-translational modifications.

    • Aspergillus expression systems: For maintaining native folding environment, particularly if the enzyme requires fungal-specific modifications.

  • Optimization protocol:

    • Temperature: Test expression at 16°C, 25°C, and 30°C

    • Induction conditions: For E. coli, optimize IPTG concentration (0.1-1.0 mM) and induction time (4-24 hours)

    • Media composition: Supplement with trace elements solution as used for native E. nidulans cultivation

  • Fusion tags: Incorporate a 6×His-tag for purification, with optional solubility-enhancing tags (SUMO, MBP, or GST) if expression yields insoluble protein.

Researchers should validate expression through SDS-PAGE and Western blotting, with optimization of conditions based on preliminary yields and solubility assessment.

What are the optimal conditions for purifying recombinant pfa5 from E. nidulans?

Purification of recombinant pfa5 from E. nidulans requires a multi-step approach to achieve high purity while maintaining enzymatic activity:

  • Cell lysis and crude extraction:

    • Buffer composition: 50 mM Tris-HCl (pH 7.5-8.0), 150-300 mM NaCl, 10% glycerol, 1 mM DTT

    • Protease inhibitors: Add PMSF (1 mM) and commercial protease inhibitor cocktail

    • Lysis method: For fungal cells, use mechanical disruption via glass beads or French press

  • Initial purification:

    • Affinity chromatography: For His-tagged pfa5, use Ni-NTA resin with imidazole gradient elution (50-300 mM)

    • Buffer optimization: Include 0.1% Triton X-100 or 0.05% Tween-20 to maintain solubility if the enzyme has membrane-associated domains

  • Secondary purification:

    • Ion exchange chromatography: Use Q-Sepharose at pH 8.0 if theoretical pI of pfa5 is below 7.0

    • Size exclusion chromatography: Final polishing step using Superdex 200 column

  • Activity preservation:

    • Storage buffer: 25 mM HEPES (pH 7.5), 150 mM NaCl, 10% glycerol, 1 mM DTT

    • Storage temperature: Aliquot and flash-freeze in liquid nitrogen, store at -80°C

Table 1: Recommended purification steps and expected outcomes

Purification StepExpected PurityTypical YieldActivity Retention
Crude Extract1-5%100%100%
Affinity (Ni-NTA)60-80%50-70%70-90%
Ion Exchange80-90%30-50%60-80%
Size Exclusion>95%20-40%50-70%

This purification scheme draws upon established protocols for fungal enzymes, including those used to isolate enzymatic components from the emericellamide biosynthetic pathway in E. nidulans .

What laboratory techniques are essential for studying pfa5 enzymatic activity?

Investigating pfa5 enzymatic activity requires multiple complementary techniques:

  • Spectrophotometric assays:

    • Develop a coupled assay system monitoring free CoA release through reaction with DTNB (5,5'-dithiobis-2-nitrobenzoic acid)

    • Measure at 412 nm with kinetic readings every 30 seconds for 10 minutes

    • Include appropriate controls: enzyme-free, substrate-free, and heat-inactivated enzyme

  • Radioisotope labeling:

    • Use [14C]-palmitoyl-CoA or [3H]-palmitoyl-CoA as substrates

    • Quantify product formation through scintillation counting after organic extraction

    • Calculate specific activity as pmol product/min/mg enzyme

  • HPLC-MS analysis:

    • Employ similar chromatographic separation methods to those used for emericellamide analysis, such as:

      • Column: C18 reverse phase (150 × 4.6 mm, 5 μm)

      • Mobile phase: Gradient of acetonitrile:water with 0.1% formic acid

      • Detection: DAD (wavelength scan 200-400 nm) coupled to MS

    • Implement mass spectrometry to identify palmitoylated products, paralleling techniques used to characterize emericellamides

  • In vivo substrate identification:

    • Use metabolomic comparison between wild-type and pfa5-deletion strains

    • Culture fungi in various carbon sources (glucose, ethanol, lipids) to identify condition-specific metabolites

    • Analyze metabolic profiles through LC-MS as performed for clinical isolate characterization

These methodologies should be adapted based on preliminary results and specific research questions regarding pfa5 functionality.

How does pfa5 relate to other acyltransferases in fungal biosynthetic pathways?

Palmitoyltransferase pfa5 likely belongs to a broader family of acyltransferases that facilitate critical steps in fungal secondary metabolism. Comparative analysis reveals several important relationships:

  • Structural and functional homology:

    • pfa5 likely shares conserved domains with other fungal acyltransferases, such as the acyltransferase EasC (AN2548.3) identified in the emericellamide biosynthetic pathway

    • These enzymes typically contain an α/β-hydrolase fold with a catalytic triad (Ser-His-Asp) essential for acyl transfer reactions

  • Pathway integration:

    • Similar to EasC, which shuttles polyketide intermediates to the thiolation domain of the nonribosomal peptide synthetase (NRPS) EasA , pfa5 likely functions within a multienzyme complex

    • This integration reflects the modular nature of fungal biosynthetic pathways, where acyltransferases often serve as bridges between different enzymatic assemblies

  • Evolutionary relationships:

    • Phylogenetic analysis of fungal acyltransferases reveals distinct clades based on substrate specificity

    • pfa5 would cluster with other palmitoyltransferases, while showing distant relationships to:

      • AcetylCoA transferases

      • Malonyl transferases

      • Other acyl-group specific enzymes

  • Substrate specificity determinants:

    • Comparison of sequence motifs around the active site reveals amino acid residues that determine chain-length specificity

    • These structural features distinguish palmitoyltransferases like pfa5 from related enzymes that transfer shorter or longer acyl chains

This contextual understanding of pfa5 within the broader landscape of fungal acyltransferases provides essential framework for experimental design and interpretation of results when studying this enzyme.

What approaches can be used to elucidate the three-dimensional structure of pfa5?

Determining the three-dimensional structure of pfa5 requires a multi-faceted approach combining computational and experimental techniques:

  • X-ray crystallography protocol:

    • Protein preparation: Further purify pfa5 to >98% homogeneity using hydrophobic interaction chromatography

    • Crystallization screening: Employ sparse matrix screens (Hampton Research, Molecular Dimensions) at 4°C and 18°C

    • Optimization conditions: Vary protein concentration (5-15 mg/ml), precipitant concentration, pH (6.0-8.5), and additives

    • Data collection parameters: Use synchrotron radiation with cryoprotection (20-25% glycerol or ethylene glycol)

  • NMR spectroscopy approach (for domains <25 kDa):

    • Express 15N/13C-labeled protein in minimal media with labeled precursors

    • Collect 2D and 3D heteronuclear spectra (HSQC, HNCO, HNCACB)

    • Assign backbone and side-chain resonances using standard triple-resonance experiments

    • Generate structural restraints through NOE measurements and residual dipolar couplings

  • Computational modeling strategy:

    • Homology modeling: Use related acyltransferase structures as templates, particularly those involved in similar biosynthetic pathways

    • Ab initio modeling: For regions lacking homology, employ Rosetta or AlphaFold

    • Molecular dynamics simulations: Refine models using explicit solvent simulations (100-500 ns)

    • Validate through Ramachandran analysis, PROCHECK, and VERIFY3D

  • Integrated structural biology:

    • Combine low-resolution techniques (SAXS, cryo-EM) with high-resolution approaches

    • Use crosslinking mass spectrometry to define domain interactions

    • Validate structural models through site-directed mutagenesis of predicted catalytic residues

This comprehensive approach would yield structural insights into substrate binding, catalytic mechanism, and potential regulatory sites of pfa5, informing further functional studies and potential inhibitor design.

How can CRISPR-Cas9 be used to study pfa5 function in E. nidulans?

CRISPR-Cas9 technology offers powerful approaches for investigating pfa5 function through precise genetic manipulation of E. nidulans:

  • Gene knockout strategy:

    • Design: Target 20-bp sequences near the 5' end of pfa5 with low off-target potential

    • Components needed:

      • Cas9 expression vector optimized for filamentous fungi

      • sgRNA expression construct with fungal promoter (e.g., gpdA)

      • Homology-directed repair template containing selection marker (pyrG or argB)

    • Transformation: Use protoplast-mediated transformation with PEG/CaCl₂

    • Validation: Confirm deletion through PCR, RT-PCR, and Western blotting

  • Point mutation introduction:

    • Design HDR template with specific mutations in catalytic residues

    • Create a library of mutants targeting predicted active site residues

    • Screen mutants for altered activity profiles to identify critical amino acids

  • Promoter replacement:

    • Replace native promoter with inducible promoter (alcA or thiA)

    • Enable controlled expression for temporal studies of pfa5 function

    • Monitor effects on secondary metabolite production under varying induction conditions

  • Tagged variant generation:

    • Create C-terminal or N-terminal fluorescent protein fusions (GFP, mCherry)

    • Examine subcellular localization in relation to known biosynthetic clusters

    • Use for co-localization studies with other enzymes in related pathways

  • Metabolic analysis of mutants:

    • Compare metabolomic profiles of wild-type, knockout, and point mutants

    • Culture in different carbon sources to identify condition-specific effects

    • Monitor changes in lipid-containing secondary metabolites

This methodological approach leverages CRISPR-Cas9 precision to dissect pfa5 function in vivo, building upon established techniques for genetic manipulation of E. nidulans biosynthetic pathways .

How does the regulation of pfa5 expression change under different environmental stresses?

The regulation of pfa5 expression likely responds dynamically to various environmental conditions, similar to other biosynthetic enzymes in E. nidulans:

  • Transcriptional response patterns:

    • Carbon source variation: Expression levels should be quantified across diverse carbon sources including:

      • Simple sugars (glucose, fructose)

      • Alternative carbon sources (ethanol, acetate)

      • Complex lipids (Tween 20, Tween 80, olive oil)

    • Nitrogen availability: Monitor expression under:

      • Nitrogen excess (6 g/l NaNO₃)

      • Nitrogen limitation (0.6 g/l NaNO₃)

      • Alternative nitrogen sources (ammonium, amino acids)

    • Temperature stress: Compare expression at:

      • Standard growth temperature (37°C)

      • Heat stress (42°C)

      • Cold stress (25°C)

  • Experimental approaches:

    • RT-qPCR methodology:

      • Reference genes: β-tubulin, actin, and glyceraldehyde-3-phosphate dehydrogenase

      • Primers efficiency: Validate at 90-110% efficiency

      • Analysis: Use 2⁻ᵈᵈᶜᵗ method with multiple reference genes

    • RNA-Seq analysis:

      • Depth: 20-30 million reads per sample

      • Replicates: Minimum three biological replicates

      • Differential expression: DESeq2 or edgeR analysis with FDR < 0.05

  • Regulation mechanisms:

Table 2: Predicted regulatory elements controlling pfa5 expression

Regulatory ElementStress ConditionExpected EffectDetection Method
CreAGlucose presenceRepressionChIP-seq, promoter analysis
FarA/FarBFatty acid presenceActivationMutant comparison, EMSA
StuADevelopmental stageTemporal regulationDevelopmental time course
PacCpH stresspH-dependent regulationGrowth at varied pH, mutant analysis
AtfAOxidative stressStress responseH₂O₂ exposure, antioxidant treatment
  • Post-transcriptional regulation:

    • Assess mRNA stability under different conditions

    • Investigate potential regulatory ncRNAs

    • Examine protein turnover rates through pulse-chase experiments

This comprehensive analysis would reveal how pfa5 expression integrates into the complex regulatory networks that govern E. nidulans metabolism under varying environmental conditions .

What are the kinetic parameters of recombinant E. nidulans pfa5 and how can they be accurately measured?

Determining accurate kinetic parameters for pfa5 requires rigorous experimental design and data analysis:

  • Experimental setup for kinetic measurements:

    • Assay conditions optimization:

      • Buffer: 50 mM HEPES or Tris-HCl, pH 7.5

      • Temperature range: 25-37°C

      • Ionic strength: 50-150 mM NaCl or KCl

      • Potential cofactors: Mg²⁺, Mn²⁺, Ca²⁺ (1-5 mM)

    • Substrate preparation:

      • Palmitoyl-CoA: Range from 1-100 μM

      • Acceptor substrate: Concentration series covering 0.1-10× predicted Kₘ

      • Controls: Include product inhibition controls

    • Reaction monitoring:

      • Continuous assay: Spectrophotometric coupling with DTNB

      • Discontinuous assay: HPLC-MS quantification of products

      • Initial velocity: Ensure <10% substrate consumption

  • Data analysis methodologies:

    • Michaelis-Menten parameters:

      • Non-linear regression using GraphPad Prism or similar software

      • Calculate Kₘ, Vₘₐₓ, kcat, and kcat/Kₘ

      • Generate Lineweaver-Burk, Eadie-Hofstee, and Hanes-Woolf plots for validation

    • Bisubstrate kinetics analysis:

      • Determine kinetic mechanism: Ping-pong, ordered sequential, or random sequential

      • Global fitting of initial velocity data to appropriate rate equations

      • Verification through product inhibition studies

  • Expected parameters and comparison table:

Table 3: Predicted kinetic parameters of pfa5 compared to related acyltransferases

Parameterpfa5 (predicted)Related AcyltransferasesExperimental Conditions
Kₘ (Palmitoyl-CoA)5-20 μM2-50 μMpH 7.5, 30°C
Kₘ (Acceptor)10-100 μM5-200 μMpH 7.5, 30°C
kcat1-10 s⁻¹0.5-20 s⁻¹pH 7.5, 30°C
kcat/Kₘ10⁵-10⁶ M⁻¹s⁻¹10⁴-10⁷ M⁻¹s⁻¹pH 7.5, 30°C
pH optimum7.0-8.06.5-8.5Varied buffers
Temperature optimum30-37°C25-40°CpH 7.5
  • Advanced kinetic investigations:

    • Temperature dependence: Calculate activation energy (Ea) from Arrhenius plot

    • pH dependence: Identify key ionizable groups through pH-rate profiles

    • Isotope effects: Use deuterated substrates to probe rate-limiting steps

This rigorous approach to kinetic characterization would provide fundamental insights into pfa5 catalytic mechanism and efficiency, enabling comparison with other acyltransferases involved in fungal biosynthetic pathways .

What role might pfa5 play in the pathogenicity of E. nidulans?

E. nidulans functions as an opportunistic pathogen in immunocompromised individuals , and pfa5 may contribute to its virulence through several mechanisms:

  • Potential virulence-associated functions:

    • Lipid metabolism modification: pfa5 may alter cell membrane composition through palmitoylation, potentially affecting:

      • Cell wall integrity during host interaction

      • Resistance to host-derived antimicrobial compounds

      • Adaptation to the host lipid environment

    • Immunomodulatory metabolite production: If pfa5 participates in biosynthesis of lipid-containing secondary metabolites, these compounds might:

      • Suppress neutrophil function

      • Interfere with macrophage recognition

      • Modulate host inflammatory responses

    • Stress adaptation: Palmitoylation of key proteins could enhance survival under host-imposed stresses:

      • Oxidative stress resistance

      • Thermal stress adaptation

      • Nutrient limitation response

  • Experimental approaches to test pathogenicity role:

    • Virulence model systems:

      • Neutrophil-deficient models (similar to those used in )

      • Pulmonary infection models

      • Cell culture invasion assays

    • Comparative virulence analysis:

      • Wild-type vs. pfa5 deletion strains

      • Complemented deletion strains

      • Point mutants with altered catalytic activity

  • Clinical relevance assessment:

    • Analysis in clinical isolates:

      • Compare pfa5 sequence and expression levels between environmental and clinical isolates

      • Investigate correlation between pfa5 polymorphisms and infection outcomes

      • Examine pfa5 expression in different infection sites

  • Mechanistic investigations:

Table 4: Proposed experiments to investigate pfa5 role in pathogenicity

Experimental ApproachHypothesis TestedExpected Outcome if Involved in VirulenceControls
Growth in lung-relevant carbon sourcespfa5 contributes to nutrient acquisitionReduced growth of deletion mutantComplemented strain
Neutrophil killing assaypfa5 products modulate neutrophil functionIncreased killing of deletion mutantHeat-killed fungi
Cell wall integrity testingpfa5 affects cell wall compositionIncreased sensitivity to cell wall stressorsOther cell wall mutants
Macrophage recognitionpfa5 products mask pathogen-associated molecular patternsAltered cytokine production with deletion mutantPurified cell wall components
In vivo virulencepfa5 is required for full virulenceAttenuated virulence of deletion mutantComplemented strain

These approaches would build upon established methodologies for investigating virulence factors in E. nidulans , focusing specifically on the potential contribution of pfa5 to pathogenicity in relevant host environments.

How can I resolve contradictory data on pfa5 substrate specificity?

Contradictory findings regarding pfa5 substrate specificity can be systematically addressed through a comprehensive experimental framework:

  • Sources of experimental variability:

    • Protein preparation differences:

      • Expression systems (E. coli, P. pastoris, native organism)

      • Purification methods affecting protein folding

      • Presence/absence of interacting proteins or cofactors

    • Assay condition variations:

      • Buffer composition and pH

      • Temperature and ionic strength

      • Detergent type and concentration for membrane-associated activity

    • Substrate preparation issues:

      • Purity of commercial substrates

      • Stability and solubility of hydrophobic substrates

      • Physiological relevance of synthetic substrates

  • Systematic resolution approach:

    • Standardized enzyme preparation:

      • Express in multiple systems in parallel

      • Implement identical purification protocols

      • Characterize protein folding via circular dichroism

      • Verify enzyme homogeneity via analytical SEC and native PAGE

    • Comprehensive substrate panel testing:

      • Acyl-CoA donors: C2-C24 with varying saturation

      • Acceptor substrates: Structural analogues with systematic modifications

      • Competition assays: Direct comparison in same reaction

    • Multiple detection methodologies:

      • Orthogonal activity assays (radiometric, spectrophotometric, MS-based)

      • Direct product identification via LC-MS/MS

      • Structure confirmation of products via NMR

  • Integrative data analysis:

Table 5: Framework for integrating contradictory substrate specificity data

ParameterApproachExpected OutcomeResolution Strategy
Substrate preferenceSide-by-side testing with standardized enzymeRank order of substrate utilizationReport specificity constants (kcat/Km) for each substrate
Conflicting kinetic parametersRepeat in standardized conditionsIdentification of condition-dependent effectsMulti-laboratory validation
Physiological relevanceIn vivo metabolomics of wild-type vs. deletionIdentification of true physiological substratesCorrelation with in vitro findings
Structural determinantsSite-directed mutagenesis of binding pocketStructure-function relationshipsMolecular modeling with docking studies
  • Metabolomic validation:

    • Compare metabolite profiles between wild-type and pfa5 deletion strains grown in different carbon sources

    • Identify specific metabolites affected by pfa5 deletion

    • Validate in vitro findings with in vivo substrate utilization

This systematic approach enables resolution of contradictory substrate specificity data through careful standardization, comprehensive substrate testing, and integration of in vitro and in vivo findings, similar to approaches used in characterizing other enzymes in E. nidulans biosynthetic pathways .

How do post-translational modifications affect pfa5 activity and regulation?

Post-translational modifications (PTMs) likely play crucial roles in regulating pfa5 activity, localization, and protein-protein interactions:

  • Identification of potential PTMs on pfa5:

    • Phosphorylation analysis:

      • Prediction: Use NetPhos 3.1 to identify potential phosphorylation sites

      • Detection: Phosphoproteomic analysis using TiO₂ enrichment followed by LC-MS/MS

      • Site validation: Generate phosphomimetic (S→D/T→E) and phospho-null (S→A/T→A) mutants

    • Other relevant PTMs:

      • Acetylation: Particularly on lysine residues near the active site

      • S-palmitoylation: Self-modification or by other palmitoyltransferases

      • Ubiquitination: Regulating protein turnover and stability

  • Functional impact assessment:

    • Activity regulation:

      • Compare enzyme kinetics of native vs. modified protein forms

      • Investigate effects of phosphatase/kinase treatment on activity

      • Examine temporal correlation between modification state and activity

    • Protein-protein interactions:

      • Identify interaction partners using co-immunoprecipitation coupled with MS

      • Compare interactome of wild-type vs. PTM-site mutants

      • Examine effects of PTMs on integration into biosynthetic complexes

    • Subcellular localization:

      • Determine if PTMs affect membrane association or organelle targeting

      • Use fluorescently tagged pfa5 variants to track localization changes

      • Correlate modification state with localization pattern

  • Dynamic regulation under different conditions:

Table 6: Predicted PTM patterns of pfa5 under different environmental conditions

Environmental ConditionPredicted PTM ChangesFunctional ConsequenceDetection Method
Nutrient limitationIncreased phosphorylationActivity modulationPhosphoproteomics
Carbon source shiftAltered acetylation patternSubstrate specificity changeAcetylome analysis
Growth phase transitionChanged ubiquitinationProtein turnover regulationUbiquitin remnant profiling
Stress conditionsMultiple PTM changesStress adaptation responseMulti-PTM proteomics
  • Regulatory network integration:

    • Map kinases and phosphatases acting on pfa5

    • Identify acetyltransferases and deacetylases modifying pfa5

    • Construct a dynamic model of pfa5 PTM-mediated regulation

This comprehensive analysis of pfa5 post-translational modifications would provide insights into the complex regulation of enzyme activity, potentially revealing mechanisms by which E. nidulans adapts its secondary metabolism to environmental changes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.