Recombinant Emericella nidulans Patatin-like phospholipase domain-containing protein AN0408 (AN0408)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
AN0408; Patatin-like phospholipase domain-containing protein AN0408
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-749
Protein Length
full length protein
Species
Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)
Target Names
AN0408
Target Protein Sequence
MEKSAAGDNIDKYSPSSIPDYDTEFLNPDDLRAFEKALTDQDADPLVALNDWRPVYQRVV RRGRGRRKSAAAAPRRTKDETREGVLYTVLKWPFLLFVLGWITFLSVGYALTRIYIFLYE QWVTWRGKRESLRRELYKHENYDDWLHAAQALDEYLGNQRWKKIDEYAYYDHLTIRKLGR QLRTVRMQVEEEMKRGESGSTVVVEELCNLLEACVKANFAGVENPRLYSEAYSGTKDLVQ DYIDEVHACVKVITDSRQARNEEKYSHFKHLDTNFGRTALCLSGGATFAYYHFGVVRALL DNEVLPSIITGTSGGALVAALVGTRTDDELKQLLVPALAHKIKACSEGFTTWARRWWRTG ARFDTMDWARQCSWFCRGSTTFREAYERTGRILNVSCVPSDPHSPTILANYLTSPNCVIW SAVLASAAVPGILNPVVLMTKKRDGTLAPYSFGHKWKDGSLRTDIPIKALNLHFNVNFTI VSQVNPHINLFFFSSRGAVGRPVTHRKGRGWRGGFLGSAIEQYIKLDLNKWLKVLRHLEL LPRPLGQDWSEIWLQKFSGTVTIWPKTVPSDFYHILSDPSPERLARMLRTGQQSTFPKIQ FIKNRLKIEYAILEGLHRFSADGESVGATSIQPFPFDNGAAGADQKSNDPREERLNRNFP ERSSEYSYDYVKSFSDFSDDPIVSAENSSVDDNYIVPSRQRDAGAEAGVGTGTAERRGSF SSLFNLEEMRRQSAVFFDDPDLYRDGGDL
Uniprot No.

Target Background

Function
Probable lipid hydrolase.
Database Links
Protein Families
PLPL family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What are the optimal storage conditions for recombinant AN0408 protein to maintain structural integrity and functional activity?

For optimal storage of recombinant AN0408 protein:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • After reconstitution, store working aliquots at 4°C for up to one week

  • For long-term storage, add 5-50% glycerol (final concentration) and store at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles as these significantly reduce protein activity

  • When handling, temporarily maintain the protein in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

Repeated freezing and thawing is strongly discouraged as it can lead to protein denaturation and loss of enzymatic activity . For experimental work spanning multiple days, prepare smaller working aliquots rather than repeatedly freezing and thawing the entire stock.

What are the critical variables to control when designing experiments with recombinant AN0408 protein?

When designing experiments with recombinant AN0408 protein, researchers should implement a systematic approach to control variables:

Variable CategorySpecific VariablesControl Method
Protein-relatedConcentration, purity, storage conditionsUse consistent protein batches, verify purity (>90% by SDS-PAGE), maintain proper storage
Buffer conditionspH, ionic strength, temperatureStandardize buffer composition, monitor pH stability, control temperature
Experimental conditionsIncubation time, substrate concentration, cofactorsUse time-course studies, substrate saturation curves, identify essential cofactors
Detection methodsAssay sensitivity, linear range, interferenceValidate assays, establish standard curves, include appropriate controls
  • Presence of endogenous phospholipases in the experimental system

  • Substrate specificity and accessibility

  • Dependency on metal ions or other cofactors

  • Temperature and pH optima for activity

A well-designed experimental protocol should include appropriate positive and negative controls, standardized reaction conditions, and replication to ensure statistical validity .

How should researchers approach reconstitution of lyophilized AN0408 protein to ensure maximal activity retention?

For optimal reconstitution of lyophilized AN0408 protein:

  • Centrifuge the vial briefly before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Allow complete dissolution by gentle mixing rather than vigorous vortexing

  • For long-term storage, add glycerol to 5-50% final concentration and aliquot

  • Test enzymatic activity using standardized assays to confirm functionality post-reconstitution

Improper reconstitution can lead to protein aggregation, denaturation, or loss of enzymatic activity. Researchers should validate protein functionality after reconstitution using activity assays specific to patatin-like phospholipase domains .

What methodological approaches are most effective for studying AN0408 protein interactions with lipid substrates?

For studying AN0408 interactions with lipid substrates, researchers should consider these methodological approaches:

  • Enzymatic activity assays:

    • Colorimetric assays measuring free fatty acid release

    • Fluorescence-based assays using labeled lipid substrates

    • Radiometric assays tracking labeled substrate conversion

  • Structural interaction studies:

    • Surface plasmon resonance (SPR) for binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Hydrogen-deuterium exchange mass spectrometry for binding interfaces

  • Cellular and in vivo approaches:

    • Lipid droplet analysis in E. nidulans with modified AN0408 expression

    • Lipidomic profiling using LC-MS/MS

    • Genetic complementation with human PNPLA3 variants

When designing such studies, researchers must carefully control experimental variables, particularly buffer composition, substrate presentation format, and detection methods, to obtain reproducible results . The patatin-like phospholipase domain's activity is often highly sensitive to experimental conditions, requiring systematic optimization.

What are common technical challenges when working with recombinant AN0408 protein, and how can they be addressed?

Researchers commonly encounter several technical challenges when working with recombinant AN0408 protein:

ChallengePotential CausesSolutions
Low enzymatic activityProtein misfolding, improper reconstitution, suboptimal assay conditionsOptimize buffer conditions, include proper cofactors, verify protein integrity by SDS-PAGE
Protein aggregationImproper storage, freeze-thaw cycles, incompatible bufferAdd stabilizing agents, use fresh aliquots, optimize pH and salt concentration
Inconsistent resultsVariable substrate quality, enzyme degradation, assay interferenceStandardize substrate preparation, include internal controls, validate assay specificity
Background activityContaminating phospholipases, non-specific hydrolysisIncrease protein purity, include specific inhibitors, use appropriate negative controls

When troubleshooting activity issues, researchers should systematically modify one variable at a time while maintaining others constant, following good experimental design principles . Documentation of all experimental conditions is essential for identifying sources of variability.

How should researchers interpret contradictory results from different assay systems when studying AN0408 function?

When faced with contradictory results from different assay systems studying AN0408 function, researchers should:

  • Evaluate assay fundamentals:

    • Compare detection mechanisms and their potential limitations

    • Assess whether assays measure the same or different aspects of protein function

    • Consider interference factors specific to each assay system

  • Analyze experimental conditions:

    • Compare buffer compositions, pH, and ionic strength

    • Evaluate substrate presentations (micelles, vesicles, emulsions)

    • Assess time points and reaction kinetics between assays

  • Implement validation strategies:

    • Use orthogonal methods to validate key findings

    • Include appropriate positive and negative controls

    • Perform dose-response or substrate titration studies

  • Consider biological context:

    • Evaluate whether in vitro conditions reflect physiological relevance

    • Compare results from purified protein vs. cellular systems

    • Assess potential cofactor requirements or inhibitory factors

Contradictory results often reveal important insights about protein function under different conditions. Rather than dismissing contradictions, researchers should use them to develop more comprehensive models of protein behavior across different contexts and experimental systems .

What are promising research avenues for elucidating the physiological role of AN0408 in Emericella nidulans?

Several promising research avenues could elucidate the physiological role of AN0408 in E. nidulans:

  • Genetic manipulation studies:

    • CRISPR-Cas9 gene editing to create AN0408 knockouts

    • Site-directed mutagenesis of catalytic residues

    • Overexpression systems to evaluate gain-of-function effects

  • Environmental response analysis:

    • Examining AN0408 expression under various nutrient conditions

    • Stress response patterns (temperature, pH, osmotic stress)

    • Role in adaptation to lipid-rich or lipid-poor environments

  • Developmental biology approaches:

    • Analyzing AN0408 expression during different fungal life cycle stages

    • Role in sporulation, germination, or hyphal development

    • Contribution to membrane remodeling during morphogenesis

  • Comparative genomics:

    • Studying evolutionary conservation across fungal species

    • Identifying functional analogs in model organisms

    • Relating structure to function across patatin-like domain proteins

Drawing parallels from human PNPLA3 research, which has revealed roles in lipid droplet remodeling and association with metabolic disorders , researchers might focus on AN0408's potential roles in fungal lipid storage, membrane homeostasis, and response to metabolic fluctuations.

How might research on AN0408 contribute to understanding broader mechanisms of lipid metabolism across species?

Research on AN0408 could contribute significantly to understanding lipid metabolism across species through:

  • Evolutionary conservation analysis:

    • Identifying fundamental mechanisms in lipid processing preserved across kingdoms

    • Distinguishing species-specific adaptations from core functionalities

    • Mapping structure-function relationships in patatin-like domains

  • Comparative pathophysiology:

    • Using insights from fungal systems to inform mammalian lipid metabolism disorders

    • Investigating parallels between fungal responses to nutrient stress and mammalian metabolic disorders

    • Developing simplified models for complex lipid processing mechanisms

  • Translational opportunities:

    • Using E. nidulans as a model organism for screening lipid metabolism modulators

    • Identifying conserved regulatory mechanisms that could represent therapeutic targets

    • Developing research tools based on AN0408 for studying lipid-protein interactions

The human PNPLA3 rs738409(G) variant shows strong association with increased hepatic lipid content and nonalcoholic fatty liver disease , suggesting that patatin-like phospholipase domain proteins play critical roles in lipid homeostasis. Understanding the fundamental mechanisms through which AN0408 functions in the simpler E. nidulans system could provide valuable insights into the more complex regulatory networks in mammals.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.