Recombinant Emericella nidulans Peroxisome assembly protein 12 (PEX12)

Shipped with Ice Packs
In Stock

Description

Introduction

Peroxisomes are vital organelles in eukaryotic cells, participating in diverse metabolic functions . These functions include $$ \beta $$-oxidation of fatty acids and the synthesis of essential compounds . Peroxisome biogenesis relies on peroxin (PEX) proteins, which mediate various steps in the formation and maintenance of peroxisomes . Among these, Peroxisome Assembly Protein 12 (PEX12) is a critical component involved in importing matrix proteins into the peroxisome .

Emericella nidulans as a Model Organism

Emericella nidulans, also known as Aspergillus nidulans, is a filamentous fungus widely used in genetic studies . Research on Emericella nidulans has provided insights into various cellular processes, including peroxisome biogenesis . Studying PEX proteins in Emericella nidulans helps elucidate the fundamental mechanisms of peroxisome assembly and function .

PEX12: A Key Peroxin

PEX12 is a RING finger peroxisomal membrane protein essential for importing matrix proteins . It plays a crucial role in the proper functioning of peroxisomes . The absence or dysfunction of PEX12 can lead to severe developmental disorders, highlighting its importance in eukaryotic organisms .

Genetic Interactions of PEX12

PEX12 interacts genetically with other RING peroxins, such as PEX2 and PEX10 . Mutants defective in any two of these RING peroxins exhibit worsened peroxisomal defects compared to single mutants, suggesting distinct functions for each RING peroxin . The pex12-1 pex2-1 double mutant displays more severe defects than the pex12-1 pex10-2 double mutant, indicating that PEX5 recycling and degradation are critical for peroxisome function .

PEX12 and Ubiquitination

PEX12 is involved in the ubiquitination of PEX5, a process crucial for the recycling of peroxisome matrix protein receptors . Studies suggest that PEX12 might monoubiquitinate PEX5 for recycling, while PEX2 polyubiquitinates PEX5 for degradation . A balance between these processes is essential for maintaining proper peroxisome function .

Emericella nidulans in Disease Control

Emericella nidulans has potential applications in biocontrol . It produces compounds that can inhibit plant diseases. For instance, Emericella nidulans can reduce the severity of Cercospora leaf spot disease in sugar beet .

Table 1: Efficiency of Emericella nidulans in Decreasing Cercospora Leaf Spot Disease Severity

Fungal IsolateDisease Severity% of Disease Inhibition
Emericella nidulans1.0078.54
Infected control3.40-
LSD at 0.050.35-

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request, but incurs additional charges. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, we can prioritize the development of a specific tag type if requested. Please indicate your preference.
Synonyms
PEX12; AN10925; Peroxisome assembly protein 12; Peroxin-12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-489
Protein Length
full length protein
Species
Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)
Target Names
PEX12
Target Protein Sequence
MEYLPSLQQEFDELKPSLFELLAEQQLSDLLPPSIRYILAVATHRHPRYLLRVLNSFDEV YALLSLVVERYYLRNFGGSFTENFYSLKRERVLLTKNGEIPRAQLGAPGPVRESLKLRNS DVWKNLLVMVGIPYLKRKLDEGYDIHAAPQASLIMNGGPRYNPSDDLPPHPTIRQRFMHA YKWFLRNVYPSFNAAYYFSILAFNLAYLFDNTKYSSPFLWLIGTRIRRLSSADHQAIAKI LEGKPQTPNSRSARSRPGSGLLGLFSPHNLYPQLLTSLRYFLPASIFALKFLEWWHASDF SRQLARKATDTLDIPAPITKGMISPSERKSRPPTKQKEDPESPKSALKTSSPHKRIQPPI SASSYLPIFTVPLPPADSDAASSCPVCLNQLTNPTACQTGYVYCYVCIFHWLNGEHQRQI DFMNGDGAGAAWEDDSGDGIDADGDRNETESAAKTGKSRHGKWESGKGRCPVTGRRVLGG TEGLRRVLI
Uniprot No.

Target Background

Function
Essential for protein import into peroxisomes.
Database Links
Protein Families
Pex2/pex10/pex12 family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and function of PEX12 in Emericella nidulans?

PEX12 in E. nidulans is a peroxisomal membrane protein characterized by a C5-type RING finger motif with five conserved cysteine residues. This structure differs from the C3HC4-type RING found in some other peroxins like PEX2 and PEX10. The protein plays an essential role in peroxisome biogenesis by facilitating the import of matrix proteins into the peroxisome.

Based on studies in other organisms, E. nidulans PEX12 likely functions as part of the peroxisomal importomer complex, working in coordination with other peroxins to enable translocation of proteins containing peroxisome targeting signals (PTS) across the peroxisomal membrane. The RING finger domain is crucial for protein-protein interactions within this complex .

How is PEX12 expression regulated in E. nidulans under different growth conditions?

The expression of PEX12 in E. nidulans likely varies based on growth conditions and developmental stages. In Arabidopsis, PEX12 expression is highest during seed development, germination, and senescence - periods when peroxisome function is particularly important . For E. nidulans, researchers should expect similar patterns of regulation tied to metabolic demands.

Expression is typically highest when the organism needs active peroxisome function, such as during growth on fatty acid carbon sources (which require β-oxidation) or in conditions generating reactive oxygen species (requiring catalase and other peroxisomal detoxification enzymes). Quantitative RT-PCR or RNA-seq analysis comparing expression levels across different growth conditions would be the recommended methodology for examining this regulation experimentally.

What phenotypes result from PEX12 mutations or knockouts in E. nidulans?

Based on studies in Arabidopsis and other organisms, PEX12 deficiency in E. nidulans would likely result in profound defects in peroxisome biogenesis. Complete knockout mutations might be lethal or severely impact growth, as observed in Arabidopsis where pex12 null mutations caused embryonic lethality .

Expected phenotypes would include:

  • Reduced or absent peroxisome formation

  • Inability to grow on carbon sources requiring peroxisomal β-oxidation (like fatty acids)

  • Defects in metabolic pathways requiring peroxisomal enzymes

  • Increased sensitivity to oxidative stress due to compromised peroxisomal antioxidant functions

  • Potential developmental abnormalities in conidiation and sexual reproduction

Researchers should employ electron microscopy to confirm the absence of peroxisomes and fluorescence microscopy with peroxisomal markers to assess import defects in partial loss-of-function mutants .

What are the most effective methods for expressing recombinant E. nidulans PEX12 protein?

For recombinant expression of E. nidulans PEX12, researchers should consider several expression systems based on their experimental goals:

  • E. coli expression systems: Useful for producing protein fragments (particularly the cytosolic domains) for structural studies or antibody production. The transmembrane domains may cause difficulties in bacterial expression.

  • Yeast expression systems: S. cerevisiae or P. pastoris can provide a eukaryotic environment more suitable for full-length PEX12 expression with proper folding and post-translational modifications.

  • Homologous expression in E. nidulans: For functional studies, expressing PEX12 fused to fluorescent proteins (like GFP or CFP) in E. nidulans itself can preserve native behavior. This approach was successful for Arabidopsis PEX12-CFP, which properly localized to peroxisomes and rescued knockout phenotypes .

Recommended methodology includes adding purification tags (His6 or GST) for protein isolation, but researchers should be cautious about tag placement to avoid interfering with the critical RING finger domain functionality.

How can researchers effectively visualize and track PEX12 localization in E. nidulans cells?

For visualizing PEX12 localization in E. nidulans:

  • Fluorescent protein fusions: Create C-terminal fusions of PEX12 with CFP or GFP under native or controlled promoters. Based on Arabidopsis studies, C-terminal fusions maintain functionality while allowing visualization .

  • Co-localization studies: Express PEX12-fluorescent protein fusions alongside established peroxisomal markers. YFP-PTS1 (containing the peroxisome targeting signal type 1) is particularly useful for confirming peroxisomal localization, as demonstrated in Arabidopsis studies .

  • Immunofluorescence microscopy: Develop antibodies against E. nidulans PEX12 for immunostaining approaches, which can avoid potential artifacts from overexpression.

  • Live-cell imaging: For dynamic studies, time-lapse microscopy of fluorescently tagged PEX12 can reveal trafficking and turnover rates.

The experimental setup should include appropriate controls to validate that the fluorescent fusion protein retains functionality, such as complementation tests in PEX12-deficient strains .

What gene silencing or knockout strategies work best for studying E. nidulans PEX12 function?

Several strategies can be employed for manipulating PEX12 expression in E. nidulans:

  • CRISPR/Cas9 gene editing: This provides precise genome editing capability for creating knockout strains or introducing specific mutations. For essential genes like PEX12, consider inducible or conditional knockout systems.

  • RNAi approaches: RNA interference can achieve partial knockdown of PEX12 expression. This approach was successful in Arabidopsis studies, where complete knockout was lethal . Two effective RNAi strategies include:

    • Virus-induced gene silencing with a fragment of the PEX12 coding sequence

    • Stable transformation with dsRNAi constructs containing inverted repeats of PEX12 fragments

  • Promoter replacement: Substituting the native promoter with regulatable promoters (e.g., alcA promoter in E. nidulans) allows controlled expression levels.

The optimal approach depends on research objectives. For studying essential functions, partial knockdown through RNAi may be more informative than lethal knockouts. When examining specific domains, targeted mutagenesis of key residues (particularly in the RING finger domain) can provide valuable functional insights .

How does the interaction network of PEX12 in E. nidulans compare with other fungal species and model organisms?

The PEX12 interaction network in E. nidulans likely shares core similarities with other eukaryotes but may have unique features reflecting its specific metabolic adaptations. Based on studies in yeast and plants, expected interaction partners include:

  • Core PEX proteins: PEX5 (PTS1 receptor), PEX10, and PEX2 (other RING peroxins)

  • The docking complex components: Including PEX13 and PEX14

  • E3 ubiquitin ligase machinery: For receptor recycling

To characterize this network experimentally:

  • Yeast two-hybrid screens: Identify direct protein interactions using PEX12 as bait

  • Co-immunoprecipitation: Pull down PEX12 complexes from E. nidulans cells

  • Proximity labeling approaches: BioID or APEX2 fused to PEX12 to identify proximal proteins

  • Comparative proteomics: Compare peroxisomal membrane proteomes between wild-type and PEX12-deficient strains

Differences between E. nidulans and other species may reveal fungal-specific adaptations that could serve as potential antifungal targets. Such comparative studies are particularly valuable given the medical relevance of E. nidulans infections, especially in immunocompromised patients with conditions like chronic granulomatous disease .

What role does PEX12 play in E. nidulans pathogenicity and virulence?

The connection between PEX12 function and E. nidulans pathogenicity remains an important area for investigation. Since E. nidulans can cause invasive aspergillosis, particularly in immunocompromised patients , understanding how peroxisome function influences virulence could reveal new therapeutic targets.

Several approaches to investigate this relationship include:

  • Infection models: Compare virulence of wild-type and PEX12-deficient strains in appropriate animal models

  • Stress response analysis: Assess how PEX12 mutations affect the fungus's ability to withstand host defense mechanisms (oxidative stress, antifungal compounds)

  • Metabolic profiling: Identify peroxisome-dependent metabolic pathways that contribute to survival in host environments

  • Transcriptomics during infection: Compare gene expression patterns between wild-type and PEX12-deficient strains during infection to identify peroxisome-dependent virulence factors

As E. nidulans infections have higher mortality rates than those caused by A. fumigatus in certain patient populations , identifying the role of peroxisomal function in this enhanced virulence could provide valuable insights for treatment strategies.

How do post-translational modifications regulate E. nidulans PEX12 function?

Post-translational modifications (PTMs) likely play important roles in regulating PEX12 function in E. nidulans, though these remain largely unexplored. Based on knowledge from other systems, relevant PTMs might include:

  • Ubiquitination: The RING finger domain of PEX12 suggests potential E3 ubiquitin ligase activity or involvement in ubiquitination processes

  • Phosphorylation: Could regulate protein-protein interactions or stability in response to metabolic changes

  • SUMOylation: May influence protein localization or complex formation

To study these modifications:

  • Mass spectrometry: Use immunoprecipitated PEX12 for PTM mapping

  • Site-directed mutagenesis: Create non-modifiable variants (e.g., phospho-null) to assess functional consequences

  • Inhibitor studies: Employ kinase or proteasome inhibitors to assess regulation by phosphorylation or ubiquitination

  • Western blot analysis: Use modification-specific antibodies to track PTM levels under different conditions

Understanding how these modifications respond to cellular stresses and metabolic states will provide insights into the dynamic regulation of peroxisome biogenesis in E. nidulans.

What are common difficulties in purifying recombinant E. nidulans PEX12 and how can they be overcome?

Purifying recombinant PEX12 presents several challenges due to its membrane protein nature:

  • Insolubility and aggregation:

    • Solution: Use mild detergents (DDM, CHAPS) for solubilization

    • Alternative: Express soluble domains separately from transmembrane regions

    • Fusion partners: Consider MBP or SUMO tags to enhance solubility

  • Low expression levels:

    • Solution: Optimize codon usage for expression system

    • Alternative: Use strong inducible promoters with careful induction parameters

    • Consideration: Test different host strains optimized for membrane protein expression

  • Protein instability:

    • Solution: Include protease inhibitors throughout purification

    • Alternative: Work at lower temperatures (4°C) during all purification steps

    • Consideration: Add stabilizing agents like glycerol to buffers

  • Maintaining native conformation:

    • Solution: Consider nanodiscs or liposome reconstitution for functional studies

    • Alternative: Employ detergent screening to identify optimal conditions

A systematic approach to optimization is recommended, testing multiple expression constructs (varying in tags, fusion partners, and expression systems) to identify the most productive combination for your specific experimental needs.

How can researchers differentiate between direct and indirect effects when studying PEX12 mutations in E. nidulans?

Distinguishing direct from indirect effects of PEX12 deficiency presents a significant challenge, as illustrated in Arabidopsis studies where PEX12 knockout affected not only peroxisomes but also lipid bodies and plastids .

Recommended approaches include:

  • Temporal analysis: Use inducible systems to track the sequence of cellular changes following PEX12 disruption; direct effects should manifest earlier than secondary consequences

  • Domain-specific mutations: Create point mutations affecting specific PEX12 functions rather than complete knockouts

  • Rescue experiments: Test whether supplementing metabolites normally produced in peroxisomes can rescue phenotypes

  • Comparative studies: Analyze multiple peroxin mutants to identify common (likely direct) versus unique (possibly indirect) effects

  • Multi-omics approaches: Combine proteomics, metabolomics, and transcriptomics to build comprehensive network models of responses to PEX12 disruption

  • In vitro reconstitution: For specific biochemical functions, reconstitute minimal systems with purified components

This multi-faceted strategy helps build a more complete understanding of PEX12's precise roles versus downstream consequences of general peroxisome dysfunction .

What are the key considerations for designing CRISPR/Cas9 targeting strategies for E. nidulans PEX12?

When designing CRISPR/Cas9 strategies for E. nidulans PEX12, researchers should consider:

  • Target site selection:

    • Choose regions with minimal off-target potential

    • Target conserved functional domains (e.g., RING finger) for specific functional studies

    • For complete knockouts, target early exons to ensure full disruption

    • Consider the C5-type RING finger motif with five conserved Cys residues as a critical functional region

  • Guide RNA design:

    • Optimize for E. nidulans codon usage

    • Check for secondary structures that might impair function

    • Use multiple guides for higher efficiency

    • Verify specificity against the E. nidulans genome

  • Delivery methods:

    • Optimize transformation protocols for the specific E. nidulans strain

    • Consider transient expression systems for Cas9 to reduce off-target effects

  • Screening strategies:

    • Design PCR primers flanking expected edit sites

    • Consider restriction enzyme sites that would be created or destroyed by edits

    • Prepare for high-throughput sequencing to identify successful edits

  • Alternative strategies for essential genes:

    • Design conditional systems if PEX12 proves essential in E. nidulans

    • Consider partial knockdowns or domain-specific mutations

Given the potential lethality of complete PEX12 knockout (as observed in Arabidopsis ), having rescue constructs or conditional expression systems available is strongly recommended.

How can single-cell approaches advance our understanding of PEX12 function in E. nidulans heterogeneous populations?

Single-cell approaches offer powerful new avenues for understanding PEX12 function across heterogeneous E. nidulans populations:

  • Single-cell RNA sequencing (scRNA-seq):

    • Reveals cell-to-cell variability in PEX12 expression

    • Identifies co-regulated gene networks at single-cell resolution

    • Can detect compensatory mechanisms in cells with different PEX12 expression levels

  • Single-cell proteomics:

    • Maps protein-level changes in response to PEX12 perturbation

    • Identifies post-transcriptional regulation mechanisms

  • Live-cell imaging with single-molecule tracking:

    • Visualizes PEX12 dynamics in individual peroxisomes

    • Quantifies protein turnover and diffusion rates

    • Detects rare events in protein trafficking

  • Microfluidics approaches:

    • Enables long-term tracking of individual cells under controlled conditions

    • Allows precise manipulation of the environment to test PEX12 responses

These techniques are particularly valuable for understanding how peroxisome biogenesis varies across different cell types and developmental stages in E. nidulans, potentially revealing specialized functions in particular cellular contexts.

What insights can comparative genomics provide about the evolution of PEX12 function across fungal species?

Comparative genomics approaches offer valuable insights into PEX12 evolution across fungi:

  • Sequence analysis across fungal lineages:

    • Identifies conserved domains and residues critical for function

    • Reveals lineage-specific adaptations

    • Maps the evolutionary history of the C5-type RING finger domain

  • Synteny analysis:

    • Examines conservation of genomic context around PEX12

    • Identifies co-evolved gene clusters

  • Selection pressure analysis:

    • Calculates dN/dS ratios to identify regions under purifying or positive selection

    • Maps selection patterns to functional domains

  • Horizontal gene transfer assessment:

    • Evaluates potential exchange of peroxisome-related genes between fungal lineages

  • Correlation with ecological niches:

    • Connects PEX12 sequence variations to specific metabolic adaptations across fungal species

    • Compares pathogenic species (like E. nidulans ) with non-pathogenic relatives

Such analyses could reveal how peroxisome functions have adapted to different ecological niches and provide insights into the development of targeted antifungal strategies that exploit differences between human and fungal peroxisome biogenesis.

What technological advances might improve our ability to study the PEX12 interactome in native peroxisomal membranes?

Recent technological advances hold promise for better characterizing the PEX12 interactome in native conditions:

  • Proximity labeling techniques:

    • TurboID or miniTurbo fused to PEX12 for rapid biotin labeling of proximal proteins

    • APEX2-based approaches for temporal control of labeling reactions

    • These methods capture transient interactions often missed by co-immunoprecipitation

  • Cross-linking mass spectrometry (XL-MS):

    • Maps spatial relationships between interacting proteins in native membranes

    • Identifies interaction interfaces at amino acid resolution

  • Cryo-electron tomography:

    • Visualizes macromolecular complexes within peroxisomal membranes at near-atomic resolution

    • Captures native architecture of the peroxisomal importomer

  • Native mass spectrometry:

    • Analyzes intact membrane protein complexes with preserved interactions

    • Determines stoichiometry and complex stability

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Maps conformational changes and protein-protein interfaces

    • Works with membrane proteins in near-native environments

These advanced techniques would help resolve outstanding questions about how PEX12 coordinates with other peroxins to facilitate protein import and how these interactions are regulated in response to metabolic demands.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.