Recombinant Emericella nidulans pH-response regulator protein palI/RIM9 (palI)

Shipped with Ice Packs
In Stock

Description

Biological Function in pH Signaling

palI is a component of the conserved fungal pH-signaling pathway, which regulates gene expression in response to ambient pH. Key mechanistic insights include:

  • Sensor Complex: Works with the 7-transmembrane protein PalH to detect alkaline pH, initiating a signaling cascade .

  • Proteolytic Activation: Facilitates the pH-dependent cleavage of the transcription factor PacC, enabling its nuclear translocation and activation of alkaline-expressed genes .

  • Endosomal Trafficking: Interacts with endosomal sorting complexes (ESCRT-III) via PalA, linking pH sensing to intracellular trafficking .

Table 2: Core Components of the Fungal pH-Signaling Pathway

ProteinRoleInteraction Partners
PalHPutative pH sensor (7TM protein)PalI
PalI4TM co-sensorPalH, PalC
PalAESCRT-III recruiterVps32, PacC
PacCTranscription factorPalA, proteases (PalB)

Recombinant Production and Applications

Recombinant palI is produced in heterologous systems for functional studies:

  • Expression Systems:

    • E. coli: Cost-effective for large-scale production, though may lack eukaryotic post-translational modifications .

    • Mammalian Cells: Suitable for producing biologically active, properly folded protein.

  • Research Applications:

    • Elucidating pH-dependent gene regulation mechanisms in pathogenic fungi .

    • Structural studies of transmembrane signaling complexes .

    • Screening antifungal agents targeting pH homeostasis .

Handling and Stability

  • Storage: Lyophilized forms retain stability for 12 months at -80°C, while liquid forms last 6 months .

  • Reconstitution: Requires careful centrifugation and glycerol addition to prevent aggregation .

  • Caution: Repeated freeze-thaw cycles degrade protein integrity; aliquoting is recommended .

Evolutionary Conservation

Homologs of palI/RIM9 exist across fungi, including:

  • Saccharomyces cerevisiae Rim9: Regulates meiosis in response to pH .

  • Magnaporthe oryzae RIM9: Involved in pathogenicity and environmental adaptation .
    This conservation underscores its fundamental role in fungal biology .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes and we will fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery timeframes, please consult your local distributor.
Note: All protein shipments are sent with standard blue ice packs. If dry ice packaging is required, please communicate this need in advance, as additional charges may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of our proteins is influenced by several factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please communicate this preference and we will prioritize its implementation in the development process.
Synonyms
palI; AN4853; pH-response regulator protein palI/RIM9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-549
Protein Length
full length protein
Species
Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)
Target Names
palI
Target Protein Sequence
MLLKPATPLTILLLIAFVLLLLSVISTPIVKSIPLATFDNVEYGVFGYCKAGTCTAIHIG YTTEEIENTGSTDSDFNLPSDARRSLSSILIVHPIAAFLTLICLCLAAAAHLHAPSHSPR YLLALLILLLPTLLVSLLAFLVDILLFVPHLSWGGWIVLAATIILVTCGVVTCAMRRTLV SRKARKRRIAENAEMSGQNYYNRQNAAAAALNESKPIAPEAKETFVAATQSSESGPTFAT FRTNTRSSDDDRTPLNNHSDPSAQDAGYQSRIPGDPVPYNAPRDDFGNPLPPGAYNSAPR MRTPGPPGPPPPDSRVRDQYSDPRRGPPTGFAPRGRGGYPPRGGYGRGGPYGGPYGPNSR APLTGRGGYMGPMRGGPAGPMARGGYRPQPAAGGYGNARAMGEDEYGYRGPSSRQRTPGP MAAPAAPGPAGQAIEMMPQPRHEPDAQDEVPEQQQLHAISIDNQHEPVSPTSLYSRTQSY VPPRRNWGPQAYQSSEPNLPYQPNQPRHARSQSGSMYYEDEDPVYTSRNESAVGNSGVPS VLTPGNSAK
Uniprot No.

Target Background

Function
Essential for the proteolytic cleavage of the transcription factor pacC in response to alkaline ambient pH. It is likely to function as a pH sensor.
Database Links
Protein Families
PalI/RIM9 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of PalI/RIM9 protein in Emericella nidulans?

PalI in Emericella nidulans (formerly Aspergillus nidulans) is a three transmembrane domain (3-TMD) protein with an N-terminal signal peptide. The protein contains a predicted luminal, conserved Gly-Cys-containing motif that distantly resembles a Gly-rich dimerization domain. PalI belongs to the Sur7 family of proteins, characterized by a signal sequence and a block of three potential transmembrane helices. The full-length PalI protein consists of 549 amino acids, with the Sur7 domain and a C-terminal extension, distinguishing it from shorter Rim9 proteins found in species like Saccharomyces cerevisiae, which contain essentially only the Sur7 domain .

What is the primary cellular localization of PalI protein?

PalI primarily localizes to the plasma membrane of fungal cells. This localization is critical for its function in the pH signaling pathway. In vitro and in vivo studies using PalI-GFP fusion proteins have confirmed this plasma membrane localization. Mutations in the conserved Gly-Cys-containing motif, particularly the Gly47Asp substitution, can disrupt this plasma membrane localization, causing the protein to be missorted into the multivesicular body pathway .

How does PalI differ from Rim9 in terms of structure and evolutionary distribution?

Based on multi-protein sequence comparisons among fungi, there are two distinct classes of Rim9/PalI proteins. The longer proteins, like PalI in Emericella nidulans, contain both a Sur7 domain and a C-terminal extension. In contrast, shorter proteins like Rim9 in Saccharomyces cerevisiae contain essentially only the Sur7 domain. Some fungal species such as E. nidulans contain only the long-form PalI-like protein, while others such as S. cerevisiae and Candida albicans possess both versions. In species with both forms, the stress response function appears to be primarily associated with the short-form protein, while in species with only the long-form protein, this element functions in the process of stress response .

How do specific mutations in the conserved Gly-Cys motif affect PalI function and localization?

The conserved Gly-Cys-containing motif in PalI is critical for both its function and proper localization. Two specific substitutions, Gly44Arg and Gly47Asp, have been demonstrated to lead to loss of function of the PalI protein. The Gly47Asp substitution is particularly disruptive as it prevents plasma membrane localization of PalI-GFP fusion proteins and causes missorting of the protein into the multivesicular body pathway. This indicates that the conserved Gly-Cys motif plays a crucial role in ensuring correct trafficking and membrane insertion of PalI, which is essential for its function in the pH signaling pathway .

What is the current model of pH signaling involving PalI in Emericella nidulans?

The current model of ambient pH signaling in E. nidulans involves two spatially segregated protein complexes. The first is a plasma membrane complex containing PalH (the likely pH sensor), PalI (which assists in PalH localization), and the arrestin-like protein PalF. The second is an endosomal membrane complex containing PalA and PalB, to which the transcription factor PacC is recruited for its proteolytic activation. While PalI is not absolutely essential for the proteolytic conversion of the PacC translation product into the processed 27-kDa form, its absence markedly reduces the accumulation of the 53-kDa intermediate after cells are shifted to an alkaline pH. This suggests that PalI enhances the efficiency of the pH signaling pathway but is not strictly required for its basic function .

What expression systems and purification strategies are most effective for recombinant PalI protein production?

For recombinant production of full-length E. nidulans PalI protein, Escherichia coli expression systems have been successfully employed. The most common approach involves expressing the full-length protein (amino acids 1-549) with an N-terminal His tag to facilitate purification. After expression, the protein is typically purified using affinity chromatography, leveraging the His tag for selective binding. The purified protein is often provided as a lyophilized powder in Tris/PBS-based buffer with 6% trehalose at pH 8.0 to maintain stability .

Table 1: Recommended Expression and Purification Parameters for Recombinant PalI

ParameterRecommended Condition
Expression SystemE. coli
Fusion TagN-terminal His tag
Protein LengthFull Length (1-549 aa)
Buffer CompositionTris/PBS-based, 6% Trehalose, pH 8.0
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
Storage-20°C/-80°C with 50% glycerol
Stability ConsiderationsAvoid repeated freeze-thaw cycles; aliquot for multiple use

What experimental approaches can be used to study PalI-PalH interactions in the pH signaling pathway?

Several experimental approaches have proven effective for studying PalI-PalH interactions:

  • Co-localization studies: Using fluorescent protein fusions (e.g., PalI-GFP and PalH tagged with a different fluorophore) to visualize the spatial distribution and co-localization of these proteins in live cells.

  • Co-immunoprecipitation: Employing differentially tagged versions of PalI and PalH (such as HA-tagged PalI and FLAG-tagged PalH) to isolate protein complexes and confirm direct interaction.

  • Genetic suppression analysis: Testing whether overexpression of one protein can compensate for mutations in the other, as demonstrated by the partial suppression of the palI32 mutation by PalH overexpression.

  • Mutational analysis: Introducing specific mutations in conserved domains of PalI (such as the Gly-Cys motif) to analyze their effects on PalH localization and function.

  • Heterologous expression systems: Expressing both proteins in controlled systems to study their interdependence for proper localization and function .

How can researchers design experiments to differentiate between the roles of PalI in different fungal species?

To differentiate between the roles of PalI across fungal species, researchers should consider the following experimental design approaches:

  • Comparative genomic analysis: Identify species with only the long-form PalI, only the short-form Rim9, or both forms. Compare protein sequences to identify conserved and divergent domains.

  • Deletion mutant phenotyping: Generate deletion mutants (ΔpalI, Δrim9, or double mutants) in different fungal species and compare phenotypes under various stress conditions, particularly alkaline pH.

  • Cross-species complementation: Test whether PalI from one species can complement the function of deleted PalI/Rim9 in another species, which can reveal functional conservation or divergence.

  • Domain swapping experiments: Create chimeric proteins with domains from PalI and Rim9 from different species to identify which regions confer specific functions.

  • Stress response assays: Compare the responses of different species and their respective mutants to alkaline pH stress, as this reveals functional differences (e.g., in S. cerevisiae and C. albicans, RIM9 but not the long-form gene is important for proper stress response) .

What methods can be used to assess the impact of PalI mutations on pH signaling pathway efficiency?

To evaluate how PalI mutations affect pH signaling pathway efficiency, researchers can employ several methodological approaches:

  • Proteolytic processing assays: Monitor the conversion of the PacC transcription factor from its full-length form to the processed 53-kDa intermediate and finally to the active 27-kDa form after shifting cells from acidic to alkaline conditions. Quantitative western blotting can measure the kinetics and efficiency of this process.

  • Transcriptional reporter assays: Use reporter genes under the control of PacC-regulated promoters to measure the transcriptional output of the pathway in wild-type versus mutant backgrounds.

  • Microscopy-based localization studies: Employ fluorescently tagged proteins to visualize the effects of PalI mutations on the localization of other pathway components, particularly PalH.

  • pH adaptation growth assays: Test the ability of mutant strains to grow under different pH conditions, particularly alkaline pH which requires functional pH signaling.

  • Phosphorylation analysis: Examine the phosphorylation status of pathway components like PalF, which is phosphorylated in response to alkaline pH in a PalH-dependent manner .

How does the PalI protein interact with other components of the fungal pH sensing mechanism?

PalI functions within a complex network of proteins in the fungal pH sensing pathway. In the prevailing model, PalI interacts primarily with PalH, the putative pH sensor, and influences the function of the arrestin-like protein PalF. The plasma membrane complex consisting of PalH, PalI, and PalF represents the first component of a two-part signaling mechanism. PalI assists in anchoring PalH to the plasma membrane, which is crucial for efficient pH sensing. Upon pH signal detection, PalF is phosphorylated and ubiquitinated in a PalH-dependent manner, triggering endocytosis and subsequent activation of the second complex. This second endosomal complex contains PalA and PalB, which facilitates the recruitment and proteolytic processing of the transcription factor PacC. Through these interactions, PalI indirectly influences the downstream transcriptional response to ambient pH changes .

What evolutionary insights can be gained from comparing PalI/RIM9 across different fungal species?

Evolutionary analysis of PalI/RIM9 across fungal species reveals significant insights into functional adaptation and specialization:

  • Functional divergence: In species containing both long-form (PalI-like) and short-form (Rim9-like) proteins, there appears to be a division of labor. The short-form proteins have specialized in stress response functions, while the long-form proteins may have adopted alternative or complementary roles.

  • Evolutionary conservation: The Sur7 domain is highly conserved across fungal species, suggesting its fundamental importance to protein function, while the C-terminal extension in long-form proteins shows more variability.

  • Species adaptation: Species containing only the long-form protein, such as E. nidulans, have adapted this protein to fulfill both the pH sensing and stress response functions that are separated in species with both forms.

  • Structural constraints: The conservation of specific motifs, such as the Gly-Cys-containing motif, across diverse fungal species suggests strong selective pressure maintaining these elements, likely due to their critical roles in protein function and localization .

Table 2: Comparison of PalI/RIM9 Features Across Fungal Species

SpeciesProtein Form(s)Primary FunctionPhenotype of Deletion
Emericella nidulansLong-form (PalI) onlypH signaling, stress responseReduced pH signaling efficiency
Saccharomyces cerevisiaeBoth long (Yol019w) and short (Rim9)Short: stress response; Long: unknownΔrim9: pH response defect; Δyol019w: no significant phenotype
Candida albicansBoth long (Srd1) and short (Rim9)Short: stress response, hyphal formation; Long: unknownΔrim9: altered response to alkaline pH; Δsrd1: no significant phenotype
Yarrowia lipolyticaRIM9 homologComponent of Pal/Rim pathwayNo effect on pH-dependent dimorphic transition

How can systems biology approaches enhance our understanding of PalI function in pH homeostasis?

Systems biology approaches offer powerful frameworks for elucidating the complex role of PalI in pH homeostasis:

  • Network modeling: Developing computational models of the entire pH signaling pathway can help predict the system-wide effects of PalI perturbations and identify non-intuitive relationships between pathway components.

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data from wild-type and palI mutant strains under various pH conditions can reveal the broader impacts of PalI function on cellular physiology.

  • Protein-protein interaction mapping: Using techniques such as BioID or proximity labeling to identify the complete interactome of PalI beyond its known interactions with PalH and PalF.

  • Quantitative phenotyping: Employing high-throughput phenotyping approaches to systematically characterize the effects of palI mutations on multiple cellular processes beyond just pH adaptation.

  • Comparative systems analysis: Analyzing how the pH response network differs between species with different PalI/RIM9 configurations to understand evolutionary adaptation of pH homeostasis mechanisms .

What controls should be included when studying recombinant PalI protein function in vitro?

When studying recombinant PalI protein function in vitro, several critical controls should be included to ensure experimental validity:

  • Negative controls:

    • Empty vector control for expression systems

    • Heat-denatured PalI protein to control for non-specific effects

    • Non-relevant transmembrane protein of similar size and structure to control for generic membrane effects

  • Positive controls:

    • Well-characterized membrane protein with known function and localization

    • If available, a functionally characterized homolog from another species

  • Mutation controls:

    • Known loss-of-function mutations (e.g., Gly44Arg and Gly47Asp in the conserved Gly-Cys motif)

    • Conserved domain deletions to assess domain-specific functions

  • Expression verification:

    • Western blot analysis to confirm proper expression and expected molecular weight

    • Immunofluorescence or other localization assays to verify proper membrane targeting

  • Functional assays:

    • pH-dependent activity measurements across a range of pH values

    • Interaction assays with known binding partners like PalH .

How can researchers overcome challenges in membrane protein isolation when working with PalI?

Isolating membrane proteins like PalI presents several challenges that can be addressed through specialized techniques:

  • Detergent selection: Screen multiple detergents (e.g., DDM, CHAPS, Triton X-100) at various concentrations to identify optimal solubilization conditions that maintain protein structure and function.

  • Expression systems optimization:

    • Consider specialized E. coli strains designed for membrane protein expression

    • Explore lower induction temperatures (16-20°C) to reduce inclusion body formation

    • Evaluate eukaryotic expression systems (yeast, insect cells) that may better support proper folding

  • Fusion tags and solubility enhancers:

    • N-terminal His tags have proven effective for PalI purification

    • Consider additional solubility-enhancing tags (MBP, SUMO, GST) that can be cleaved post-purification

  • Reconstitution approaches:

    • Nanodiscs or liposomes can provide a native-like membrane environment

    • Prepare protein in buffer containing 6% trehalose at pH 8.0 to enhance stability

  • Storage considerations:

    • Store at -20°C/-80°C with 50% glycerol as a cryoprotectant

    • Avoid repeated freeze-thaw cycles by preparing single-use aliquots

    • For working stocks, maintain at 4°C for up to one week .

What experimental approaches can resolve conflicting data on PalI function across different fungal models?

When faced with conflicting data on PalI function across different fungal models, researchers should employ these methodological approaches:

  • Standardized experimental conditions:

    • Develop a common set of pH shift protocols and growth conditions

    • Use identical media compositions adjusted only for species-specific requirements

    • Standardize protein extraction and detection methods

  • Cross-laboratory validation:

    • Perform key experiments in multiple laboratories using identical protocols

    • Exchange strains and reagents to eliminate sources of variation

  • Heterologous expression studies:

    • Express PalI from different species in a common host organism

    • Test functional complementation across species

  • Domain-specific analysis:

    • Create chimeric proteins containing domains from different species

    • Systematically test which domains confer specific functions

  • High-resolution phenotyping:

    • Move beyond binary (growth/no growth) phenotypes to quantitative measurements

    • Monitor multiple outputs of pH signaling simultaneously

    • Track temporal dynamics of the response rather than endpoint measurements

  • Genetic background considerations:

    • Test mutations in multiple strain backgrounds within each species

    • Create isogenic strains where possible to minimize confounding genetic variation .

What emerging technologies could advance our understanding of PalI dynamics in living cells?

Several cutting-edge technologies show promise for elucidating PalI dynamics in living cells:

  • Super-resolution microscopy: Techniques such as STORM, PALM, or lattice light-sheet microscopy can visualize PalI localization and dynamics at nanometer resolution, revealing previously undetectable spatial arrangements and movement patterns.

  • Single-molecule tracking: Following individual PalI molecules tagged with photoactivatable fluorescent proteins to determine diffusion rates, clustering behavior, and interactions with other proteins in response to pH changes.

  • Optogenetics: Developing light-controllable versions of PalI or its interaction partners to precisely manipulate the pH signaling pathway with spatiotemporal control.

  • CRISPR-based imaging: Using catalytically inactive Cas proteins fused to fluorescent markers to visualize the genomic loci encoding PalI and related proteins, potentially revealing coordinated transcriptional responses.

  • Cryo-electron microscopy: Determining the high-resolution structure of PalI alone and in complex with other pathway components to understand the molecular basis of its function.

  • Biosensors: Developing FRET-based or other fluorescent biosensors that can report on PalI conformational changes or interactions in real-time during pH fluctuations .

How might insights from PalI research be applied to antifungal drug development?

The pH sensing pathway involving PalI represents a potential target for novel antifungal therapeutics:

  • Pathway-specific targeting: Since the Pal/Rim pathway is fungal-specific with no direct homologs in humans, targeting components like PalI could provide selective antifungal activity with minimal host toxicity.

  • Virulence modulation: In pathogenic fungi, pH adaptation is often crucial for virulence. Compounds that disrupt PalI function could potentially reduce pathogenicity without necessarily killing the fungus, potentially reducing selective pressure for resistance.

  • Combination therapy approaches: Inhibitors of PalI or its interactions could sensitize fungi to existing antifungals or environmental stresses, allowing for lower doses or more effective treatment regimens.

  • Species-specific targeting: The differences in PalI/RIM9 structure and function between fungal species could be exploited to develop species-specific antifungals, particularly against medically important pathogens like Candida albicans.

  • Structure-based drug design: As structural information about PalI becomes available, rational design of small molecules that interfere with critical interactions or conformational changes could yield effective inhibitors.

  • Screening approaches: High-throughput screens could identify compounds that specifically disrupt PalI localization or its interaction with PalH, potentially identifying new classes of antifungal compounds .

What is the potential role of PalI in fungal adaptation to environmental stresses beyond pH?

While PalI is primarily associated with pH sensing, emerging evidence suggests broader roles in fungal stress adaptation:

  • Cross-talk with other signaling pathways: PalI may interact with components of other stress response pathways, creating an integrated network for responding to multiple environmental challenges simultaneously.

  • Membrane organization functions: As a membrane protein with similarities to Sur7 family proteins, PalI may play roles in membrane organization, potentially affecting responses to membrane stressors like antifungal drugs or osmotic pressure.

  • Cell wall integrity: pH adaptation is often linked to cell wall remodeling in fungi. PalI might indirectly influence cell wall integrity pathways, affecting resistance to cell wall-targeting compounds.

  • Nutrient acquisition: Environmental pH strongly influences nutrient availability. PalI-mediated signaling might coordinate pH adaptation with changes in nutrient acquisition strategies.

  • Biofilm formation: In pathogenic species, pH sensing is often linked to biofilm formation. PalI could potentially influence this process, affecting a major virulence factor.

  • Developmental transitions: As seen in Yarrowia lipolytica, components of the Rim pathway may be involved in pH-dependent dimorphic transitions. Further research could reveal additional roles for PalI in fungal development and morphogenesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.