Recombinant Emericella nidulans Presequence translocated-associated motor subunit pam17, mitochondrial (pam17)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
pam17; AN10067; Presequence translocated-associated motor subunit pam17, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
88-252
Protein Length
Full Length of Mature Protein
Species
Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)
Target Names
pam17
Target Protein Sequence
NSTTSTSAREEAAKLDWNSYFKLRASRRRYTLASSIVSSAVSTVVGVQVLSSQNLENLGA QVMGLDPFVVLGMATAACGAVGWLVGPFLGNAVWGLVNRSYKKAFLVKEKEFFDRIKRYR VDPSSNSMTNPVPDYYGEKIGSVQGYRQWLKDQRAYNRKRRSFIK
Uniprot No.

Target Background

Function
A component of the PAM complex, essential for the ATP-dependent translocation of transit peptide-containing proteins from the inner mitochondrial membrane to the mitochondrial matrix.
Database Links
Protein Families
PAM17 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of Pam17 in mitochondrial protein import?

Pam17 functions as a critical subunit of the presequence translocase-associated motor (PAM) that drives the completion of preprotein translocation into the mitochondrial matrix. As demonstrated through knockout studies, Pam17 is specifically required for the import of matrix-targeted proteins but not for proteins with hydrophobic stop-transfer sequences that get inserted into the inner membrane . Mechanistically, Pam17 is anchored in the mitochondrial inner membrane with exposure to the matrix side and plays an essential role in organizing other components of the import motor, particularly the Pam16-Pam18 complex . This organization is crucial for generating the import-driving activity required for proper protein translocation.

How is Pam17 synthesized and processed in cells?

Pam17 is synthesized as a precursor protein with a cleavable presequence. Experimental evidence using radiolabeled precursor proteins shows that Pam17 migrates more slowly on SDS-PAGE than its mature form . When incubated with isolated mitochondria in the presence of a membrane potential (Δψ), the precursor is processed to the mature-sized form. This processing is inhibited when the membrane potential is dissipated, confirming that Pam17 is imported via the typical presequence-dependent import pathway . After import, mature Pam17 becomes anchored in the inner mitochondrial membrane with its main functional domain exposed to the matrix compartment.

What is the relationship between Pam17 and other components of the protein import machinery?

Pam17 interacts with multiple components of the mitochondrial protein import machinery, particularly:

PAM ComponentInteraction with Pam17Functional Significance
Pam16-Pam18 complexRequired for stable complex formationRegulates mtHsp70 ATPase activity
TIM23 complexAssociates with the presequence translocaseFacilitates protein translocation across inner membrane
Tim44Sequential functional cooperationTim44 promotes further translocation after Pam17's initial action
mtHsp70Indirect regulation via Pam16-Pam18Affects binding of mtHsp70 to incoming polypeptides

Although Pam17 is not a stable subunit of the Pam16-Pam18 complex itself (as shown by BN-PAGE analysis where Pam17 migrates in a separate ~50 kDa band), it is essential for the stable association of Pam16 and Pam18 with each other and with the TIM23 complex . Studies with pam17Δ mitochondria demonstrate reduced copurification of Pam16 and Pam18 with tagged Tim23, indicating Pam17's critical role in organizing these components .

What are the molecular mechanisms by which Pam17 affects mitochondrial protein import?

Pam17 influences mitochondrial protein import through several interconnected mechanisms:

  • Organization of Import Motor Components: Pam17 is crucial for maintaining the stability of the Pam16-Pam18 complex and promoting its association with the TIM23 translocase. In pam17Δ mitochondria, the BN-stable association of Pam16 and Pam18 is strongly impaired .

  • Sequential Protein Import Process: Research indicates that Pam17 functions at an early stage of protein translocation, while Tim44 assists in a later step of transport. Specifically, Pam17 facilitates the interaction of Ssc1 (mtHsp70) with the incoming polypeptide, while Tim44 promotes further translocation of the protein into the matrix .

  • Import-Driving Activity: Pam17 is required for the Δψ-independent motor activity with two-membrane-spanning preproteins. Experimental data shows that in pam17Δ mitochondria, most of the intermediate-sized b₂(220)-DHFR is degraded by external protease, indicating impaired import-driving activity of PAM .

  • Maintenance of Pam18 Levels: Studies of cells grown at elevated temperatures (37°C) reveal that pam17Δ mitochondria show reduced steady-state levels of Pam18, suggesting Pam17 plays a role in maintaining Pam18 stability .

How does the function of Pam17 differ between posttranslational and cotranslational protein import?

Pam17 shows particular importance for posttranslational protein import pathways. In experiments where preproteins were accumulated in the cytosol of pam17Δ cells by reducing the mitochondrial membrane potential with CCCP, and then monitoring subsequent import after restoration of the membrane potential, a significant defect was observed .

Quantitative analysis revealed that in wild-type cells, accumulated precursor decreased from 21.3% to 2.7% within 45 minutes, while in pam17Δ cells, the decrease was only from 28.3% to 14.9% in the same period . This finding indicates that Pam17 plays a more critical role in the posttranslational import pathway than in cotranslational import, likely due to its role in facilitating the early interaction of mtHsp70 with incoming polypeptides.

What phenotypes are observed in yeast cells lacking Pam17?

Yeast cells lacking Pam17 (pam17Δ) exhibit several characteristic phenotypes:

PhenotypeDescriptionExperimental Evidence
Growth defectsPresent but variable depending on conditionsStronger at elevated temperatures
Matrix protein importStrongly impairedIn vitro import assays with radiolabeled preproteins
Inner membrane protein insertionNormal or minimally affectedImport of preproteins with stop-transfer sequences
PAM motor activitySignificantly reducedΔψ-independent import assays
Pam16-Pam18 complex stabilityDisruptedBN-PAGE analysis showing reduced complex formation
Association with TIM23Reduced for Pam16-Pam18Copurification experiments with tagged Tim23

Interestingly, there is an apparent discrepancy between the relatively mild in vivo growth phenotype of pam17Δ cells under most conditions and the strong in vitro import defects. This suggests that compensatory mechanisms may exist in vivo or that the import defect primarily affects a subset of mitochondrial proteins .

What are effective approaches to study Pam17's interactions with other components of the protein import machinery?

Several complementary approaches can be employed to study Pam17's interactions:

  • Affinity Purification and Co-Immunoprecipitation:

    • Tag Pam17 or other import components (e.g., with Protein A or His tags)

    • Perform pulldowns to identify interacting partners

    • Example approach: Chacinska et al. isolated TIM23-PAM from wild-type and pam17Δ mitochondria via tagged Tim23 to analyze the impact of Pam17 deletion on complex composition

  • Blue Native PAGE (BN-PAGE):

    • Used to visualize intact protein complexes

    • Can determine if Pam17 directly incorporates into complexes or affects their formation

    • From published data: Pam17 migrates as a distinct ~50 kDa band, separate from the ~80 kDa Pam16-Pam18 complex

  • Chemical Crosslinking:

    • Apply crosslinking agents to capture transient interactions

    • Analyze by mass spectrometry to identify crosslinked peptides

    • Reference: Studies have used 4-DPS for oxidative crosslinking to analyze Tim17 interactions

  • In Vitro Reconstitution:

    • Purify individual components and test direct interactions

    • Reconstitute minimal functional complexes to test activity

    • Useful for determining if interactions are direct or indirect

  • Two-Membrane-Spanning Preprotein Accumulation:

    • Accumulate chemical amounts of preproteins in mitochondrial import sites

    • Isolate the preprotein-TOM-TIM23-PAM supercomplex

    • Example: b₂(167)Δ-DHFR with methotrexate forms a stable preprotein-translocase complex that can be isolated

These approaches have demonstrated that Pam17 associates with TIM23-PAM components but is not a stable subunit of the Pam16-Pam18 complex itself, instead playing a regulatory role in its formation and stability .

How can researchers generate and characterize Pam17 mutants to study structure-function relationships?

Researchers can utilize the following approaches to generate and characterize Pam17 mutants:

  • Site-Directed Mutagenesis:

    • Target conserved residues identified through sequence alignment of Pam17 from different species

    • Create alanine-scanning mutants to identify functional regions

    • Generate mutants based on structural predictions from homology modeling

  • Plasmid Shuffling Approach:

    • Use a system similar to that employed for Tim17 studies

    • Create a shuffle strain (e.g., pam17Δ + plasmid with wild-type PAM17)

    • Transform with plasmids encoding mutant versions

    • Select on 5-FOA to eliminate the wild-type copy

    • Non-viable mutants indicate essential functions

  • Growth Phenotype Analysis:

    • Test mutants under various conditions (temperature, carbon sources)

    • Perform synthetic genetic interaction studies with mutations in other import components

    • Example: Temperature-sensitive phenotypes like those observed with tim17 mutants

  • In Vitro Import Assays:

    • Isolate mitochondria from mutant strains

    • Test import of various radiolabeled precursor proteins

    • Compare matrix-targeted vs. inner membrane-sorted precursors

    • Analyze Δψ-dependent and -independent steps separately

  • PAM Complex Assembly Analysis:

    • Use BN-PAGE to determine effects on Pam16-Pam18 complex formation

    • Perform co-immunoprecipitation with tagged Tim23 to assess association with the translocase

    • Analyze protein levels of other PAM components (particularly Pam18, which shows reduced levels in pam17Δ mitochondria)

A systematic approach like this would provide comprehensive insights into which regions of Pam17 are critical for its various functions in protein import.

How should researchers interpret discrepancies between in vivo and in vitro phenotypes of Pam17 mutants?

The apparent discrepancy between mild in vivo growth phenotypes and strong in vitro import defects in Pam17 mutants requires careful interpretation:

  • Potential Explanations:

    FactorMechanismExperimental Approach
    Redundant pathwaysAlternative import mechanisms compensate in vivoTest import of diverse substrates; analyze genetic interactions
    Growth conditionsLaboratory conditions may not stress the import systemTest growth under respiratory conditions or protein misfolding stress
    Substrate specificityOnly subset of proteins affectedPerform proteomic analysis of mitochondria from mutant strains
    Temporal effectsSlow import vs. complete blockConduct time-course experiments for import
    CompensationUpregulation of other import componentsAnalyze protein levels of other import machinery components
  • Investigation Approaches:

    • Compare posttranslational vs. cotranslational import efficiency

    • Analyze synthetic genetic interactions with other PAM components (e.g., tim44 and ssc1 mutations)

    • Test the effect of accumulating preproteins in the cytosol by temporarily reducing mitochondrial membrane potential

    • Examine the influence of different carbon sources on growth phenotypes

  • Case Study Interpretation:
    Research has shown that Pam17 is involved in an early step of import, facilitating the interaction of Ssc1 with incoming polypeptides, while Tim44 promotes further translocation . This functional overlap may explain why pam17Δ cells grow similarly to wild-type under most conditions, despite showing import defects in vitro. The synthetic enhancement of phenotypes when PAM17 deletion is combined with mutants of essential import motor genes (SSC1 and TIM44) confirms this interpretation .

What controls should be included when analyzing protein import defects in Pam17 mutants?

When analyzing protein import defects in Pam17 mutants, the following controls are essential:

  • Substrate Controls:

    • Matrix-targeted preproteins (should show defects in pam17Δ mitochondria)

    • Inner membrane-sorted preproteins with stop-transfer signals (should be minimally affected)

    • Carrier proteins imported via TIM22 pathway (should be unaffected)

  • Mitochondrial Integrity Controls:

    • Membrane potential measurements (Δψ) to ensure import defects aren't due to collapsed membrane potential

    • Analysis of mitochondrial morphology and general protein composition

    • Verification of other TIM23 and PAM component levels

  • Experimental Condition Controls:

    • Temperature controls (perform assays at both permissive and non-permissive temperatures)

    • ATP levels and regenerating system consistency

    • For heat shock experiments: proper controls as used in Tim17 studies (e.g., incubation at 37°C for 10 min)

  • Methodological Controls:

    • For BN-PAGE analysis: compare multiple detergent conditions to ensure complex stability

    • For in vitro import: use both Δψ-dependent and Δψ-independent assays to distinguish between defects in initial translocation vs. motor activity

    • For crosslinking: include non-crosslinked samples and controls with unrelated proteins

  • Genetic Controls:

    • Compare phenotypes with known mutants (e.g., tim44 mutants) to calibrate severity

    • Use compensatory mutations to verify specificity of phenotypes

    • Include tests for synthetic genetic interactions

The research demonstrating selective impairment of matrix protein import but normal inner membrane protein insertion in pam17Δ mitochondria exemplifies the importance of including different types of preproteins as controls .

How can researchers troubleshoot common issues in Pam17 functional studies?

IssuePotential CausesTroubleshooting Approaches
Poor expression of recombinant Pam17Protein toxicity, codon bias, improper foldingLower induction temperature; optimize codons; express as fusion protein; use different E. coli strains
Inconsistent import resultsVariable mitochondrial qualityStandardize isolation procedure; verify membrane potential; ensure consistent ATP levels; use fresh mitochondria
No detectable Pam17-dependent phenotypesRedundant pathways; non-stressful conditionsTest multiple substrates; use temperature stress; deplete multiple PAM components simultaneously
Difficulty detecting Pam17 interactionsTransient interactions; complex disruption during isolationUse chemical crosslinking; optimize detergent conditions; employ proximity labeling techniques
Conflicting results between growth and biochemical assaysDifferent sensitivities; compensatory mechanismsPerform time-course analyses; test under respiratory conditions; analyze synthetic genetic interactions
Degradation of Pam17 during purificationProtease sensitivityInclude multiple protease inhibitors; optimize buffer conditions; reduce purification time

When investigating the reduction in Pam16-Pam18 complex stability in pam17Δ mitochondria, researchers should ensure they're working with cells grown at low temperature to avoid indirect effects due to lowered levels of Pam18 . Additionally, analyzing both the TIM23 association of Pam16-Pam18 via copurification with tagged Tim23 and their direct interaction via BN-PAGE provides complementary insights into the specific role of Pam17 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.