Recombinant Emericella nidulans Probable endonuclease lcl3 (lcl3)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate requests whenever possible.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate requests whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your preferred tag type; we will prioritize fulfilling requests whenever feasible.
Note: While the tag type is determined during production, please specify your preferred tag type; we will prioritize fulfilling requests whenever feasible.
Synonyms
lcl3; AN0258; Probable endonuclease lcl3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-280
Protein Length
full length protein
Species
Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)
Target Names
lcl3
Target Protein Sequence
MRWPPWSSKTQEPTIADDKQQNCTSLLPVTTNQTDKAAILDWAAFTELRTLIPTLILTTA
ILSAARFHRSYLRRFPDAPSIDAAYFRRRSIYGKVTSVGDGDNFRIFHTPGGRLAGWELL
PWKRIPKGKKELRDNTIHVRLAGIDAPELAHFGRPEQPYAREAHEWLTSYLLSRRVRAYL
HRPDQYQRVVATVYVRRVLDFPIPFRRRDVSYEMLRRGLATVYEAKSGAEFGGDAIEAKY
RNAEWWAKLKGNGMWKGFRRNKEFESPREYKTRVGLEEKK
Uniprot No.
Target Background
Database Links
KEGG: ani:AN0258.2
STRING: 162425.CADANIAP00002466
Protein Families
LCL3 family
Subcellular Location
Mitochondrion. Membrane; Single-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
