Recombinant Emericella nidulans Protein yop1 (yop1)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties

Recombinant Expression Workflow

  1. Gene Cloning: The yop1 gene (AN2279) is inserted into an E. coli-compatible vector.

  2. Induction: Protein expression is induced under optimized conditions.

  3. Purification: Affinity chromatography using His-tag binding resins .

Quality Control

  • Rigorously validated via SDS-PAGE and mass spectrometry to ensure >90% purity .

Functional Insights

Putative Roles
While direct functional data for yop1 is limited in public databases, proteomic studies of recombinant A. nidulans strains provide contextual insights:

  • Metabolic Stress: Recombinant protein production in A. nidulans upregulates energy pathways (e.g., TCA cycle, pentose phosphate pathway) to meet biosynthetic demands .

  • Secretion Challenges: Heterologous expression triggers endoplasmic reticulum (ER) stress and oxidative stress responses, suggesting yop1 may require chaperones like BipA or PDI for proper folding .

Pathway Associations

  • Hypothesized to interact with membrane trafficking proteins based on homology to yeast Yop1p, which regulates ER tubulation .

Research Applications

Experimental Use Cases

  • Protein Interaction Studies: Used in yeast two-hybrid screens to identify binding partners .

  • Structural Biology: Serves as a substrate for crystallography or NMR due to its solubility in Tris-glycerol buffers .

  • Fungal Physiology: Serves as a model protein for studying secretion bottlenecks in Aspergillus species .

Key Findings from Proteomic Studies

  • Recombinant A. nidulans strains producing heterologous proteins show:

    • Enriched Pathways: Energy metabolism (+25%), amino acid biosynthesis (+18%), ribosomal biogenesis (+15%) .

    • Stress Markers: Overexpression of ER chaperones (e.g., BipA) and redox enzymes (e.g., catalases) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance. Additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability. In general, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specified tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
yop1; AN2279; Protein yop1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)
Target Names
yop1
Target Protein Sequence
MASFQDRAQHTIAQLDKELSKYPVLNNLERQTSVPKVYVILGLGGIYTFLVFFNIAGQLL VNLAGFILPTYYSLDALFSAGKADDTQWLTYWVVYAFFTVVESAISAPYWFPFYYIFKFA LVLWLALPQTNGAQIVFKSLVQPLVGRYFTGGSTSANLRAQADAATKSQ
Uniprot No.

Target Background

Function
This protein is involved in membrane/vesicle trafficking.
Database Links
Protein Families
DP1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for Recombinant Emericella nidulans Protein yop1(yop1)?

For optimal preservation of activity and stability, Recombinant Emericella nidulans Protein yop1(yop1) should be stored at -20°C for regular use, or at -80°C for extended storage periods. The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which is optimized for this specific protein. When working with the protein, it is recommended to prepare working aliquots and store them at 4°C for up to one week maximum. Repeated freezing and thawing cycles should be avoided as they can lead to protein degradation and loss of activity .

How does Emericella nidulans compare to other filamentous fungi for recombinant protein expression?

Emericella nidulans (Aspergillus nidulans) represents an important filamentous fungal expression system with distinct advantages compared to other hosts. Unlike yeast systems such as Saccharomyces cerevisiae and Schizosaccharomyces pombe, E. nidulans shares more genetic features with other filamentous fungi, making it suitable for expressing proteins from related species. When compared to Aspergillus niger, E. nidulans often provides different post-translational modifications and may yield different isoforms of the same protein .

For example, when the laccase (Lcs-1) from Ceriporiopsis subvermispora was expressed in both A. nidulans and A. niger, the enzyme produced in A. nidulans showed multiple active isoforms similar to the native enzyme, while A. niger produced only a single isoform. This indicates that A. nidulans may provide protein modifications more similar to the native hosts for certain proteins, which can be crucial for accurate characterization of enzyme specificity and activity .

What expression systems and promoters are most effective for yop1 production in laboratory settings?

For controlled expression of proteins like yop1 in Emericella nidulans, several inducible promoter systems have proven effective in laboratory settings. Two particularly useful inducible promoters are:

  • Nitrate reductase (niaD) promoter: This promoter can be induced by the presence of nitrate in the growth medium, allowing for controlled timing of protein expression.

  • ATP sulfurylase (met3) promoter: This promoter is regulated by methionine, being repressed in the presence of methionine and induced in its absence. Though less well-studied in filamentous fungi than the niaD promoter, it offers an alternative induction mechanism .

For experimental verification of promoter activity, researchers often use reporter systems such as the Beta-glucuronidase (GUS) reporter gene. For example, the met3 promoter isolated from Aspergillus nidulans can be inserted upstream of the GUS coding region, allowing visual confirmation of expression under different conditions .

What challenges are associated with heterologous expression of proteins in filamentous fungi, and how can they be addressed when working with yop1?

Heterologous protein expression in filamentous fungi presents several challenges that researchers should anticipate when working with proteins like yop1:

  • Extracellular proteases: Endogenous proteases secreted by the host can degrade the heterologous protein. This issue can be addressed by:

    • Using protease-deficient strains

    • Selecting hosts with naturally low protease activity, such as Aspergillus vadensis or Aspergillus japonicus

    • Optimizing culture conditions to minimize protease activity

  • Post-translational modifications: Different fungal hosts can produce varying glycosylation patterns and other post-translational modifications, potentially affecting protein function. For example, when P. cinnabarinus Lac1 was expressed in yeasts (Yarrowia lipolytica and Pichia pastoris), it resulted in hyperglycosylated variants with considerably lower activity compared to expression in Aspergillus species .

  • Expression yield variability: There can be significant differences in production titers between different strains of the same species. For instance, production of laccase (Lcc1) from Trametes trogii showed one to two orders of magnitude difference when expressed in nine different strains of Kluyveromyces lactis .

To address these challenges when working with yop1, researchers should consider preliminary expression tests in multiple host strains, optimize growth media to control pH and minimize protease activity, and verify protein functionality with appropriate activity assays.

What purification strategy is recommended for isolating recombinant yop1 protein with high purity?

While the search results don't provide specific purification strategies for yop1 protein, a general methodological approach for purification of recombinant proteins from filamentous fungi would include:

  • Initial clarification: Centrifugation of culture supernatant (if the protein is secreted) or cell lysis followed by clarification (if the protein is intracellular)

  • Affinity chromatography: Utilizing tags that may be incorporated into the recombinant construct. The tag type for the commercial yop1 protein is determined during the production process, as indicated in the product information .

  • Size exclusion chromatography: For further purification based on molecular size

  • Ion exchange chromatography: Based on the theoretical isoelectric point of yop1

For quality control, SDS-PAGE should be performed to verify purity, and mass spectrometry can confirm protein identity. Additionally, specific activity assays relevant to yop1's function would be recommended to ensure the purified protein is biologically active.

How can genetic modification techniques be used to improve yop1 expression and functionality?

Advanced genetic modification approaches can enhance both the expression and functionality of recombinant yop1:

  • Codon optimization: Adjusting the coding sequence to match the codon usage bias of E. nidulans can significantly improve translation efficiency.

  • Signal peptide optimization: For secreted proteins, testing different signal peptides can improve secretion efficiency. The A. niger glucoamylase (glaA) pre-pro-sequence (24 amino acids) has been successfully used for expression of various proteins in Aspergillus species .

  • Promoter selection and engineering: As demonstrated in A. nidulans research, the choice of promoter can dramatically affect expression levels. The alcA promoter system has been used effectively for controlled expression of genes in A. nidulans . This system allows for nutritional induction, enabling researchers to control the timing of protein expression.

  • Strain engineering: Deletion or modification of genes involved in the G-protein system (G1, G, GprB) has been shown to affect fungal growth and development in Aspergillus species, which could potentially be leveraged to improve protein production .

  • Chromosomal integration site selection: The genomic location where the expression cassette integrates can significantly impact expression levels due to positional effects.

For experimental validation, comparison of different strategies using quantitative methods such as Western blotting, enzyme activity assays, or reporter systems is recommended.

What are the potential roles of yop1 in cellular organization and membrane dynamics in filamentous fungi?

Based on protein homology and the amino acid sequence provided, yop1 appears to be a membrane protein that may play roles in:

  • Endoplasmic reticulum morphology: Yop1p homologs in other organisms are involved in maintaining the curvature of ER tubules.

  • Membrane trafficking: The protein may function in vesicular transport between organelles.

  • Cellular development: Given that developmental regulatory genes in A. nidulans have been shown to cause growth inhibition and development at inappropriate times when overexpressed , yop1 might have regulatory functions in fungal development.

To investigate these potential roles, researchers could employ:

  • Localization studies using fluorescent protein fusions to determine the subcellular distribution of yop1

  • Gene deletion or conditional expression studies to observe phenotypic effects

  • Protein-protein interaction studies to identify binding partners

  • Lipidomic analysis to detect changes in membrane composition in yop1 mutants

How does post-translational modification of yop1 differ when expressed in various fungal hosts?

Post-translational modifications (PTMs) can vary significantly between different fungal expression hosts, affecting protein functionality. While specific data on yop1 PTMs is not provided in the search results, research on other proteins provides valuable insights:

Host OrganismTypical N-glycosylation PatternImpact on Protein PropertiesExamples from Literature
Emericella nidulansComplex N-glycosylation, potentially with multiple isoformsOften preserves activity profiles similar to native proteinsLcs-1 laccase expressed in A. nidulans showed multiple active isoforms similar to the native enzyme
Aspergillus nigerOften higher molecular mass, potentially different glycosylation patternsMay alter substrate specificity and activityLcs-1 laccase expressed in A. niger showed a single isoform with higher molecular mass than the native enzyme
Pichia pastorisTendency toward hyperglycosylationCan significantly reduce specific activityP. cinnabarinus Lac1 expressed in P. pastoris showed hyperglycosylation and low activity (0.1 U/ml)
Yarrowia lipolyticaHyperglycosylation observedCan impair enzyme performanceP. cinnabarinus Lac1 expressed in Y. lipolytica showed reduced activity (0.4 U/ml)

To experimentally determine PTMs on yop1 expressed in different hosts, researchers should consider:

  • Treatment with endoglycosidases followed by SDS-PAGE analysis to assess N-glycosylation

  • Mass spectrometry analysis to identify specific modifications and their attachment sites

  • Activity assays to determine the functional impact of different PTM patterns

What are common issues in detecting and quantifying recombinant yop1 protein expression?

Researchers frequently encounter several challenges when detecting and quantifying recombinant yop1 protein:

  • Low expression levels: This may result from inefficient transcription, translation, or rapid protein degradation. Methodological solutions include:

    • Testing different promoters (e.g., nitrate reductase [niaD] promoter or ATP sulfurylase [met3] promoter)

    • Optimizing culture conditions (temperature, pH, media composition)

    • Monitoring expression at different time points to identify optimal harvest time

  • Protein degradation: Endogenous proteases can degrade heterologous proteins, resulting in low or undetectable product. To address this:

    • Consider using protease-deficient strains

    • Add protease inhibitors during extraction

    • Select host species with low extracellular protease activity, such as Aspergillus vadensis

  • Detection difficulties: If antibodies against yop1 are unavailable, consider:

    • Using epitope tags (His, FLAG, etc.) that can be detected with commercial antibodies

    • Developing specific activity assays based on yop1's predicted function

    • Using mass spectrometry for identification and quantification

  • Protein insolubility or misfolding: Membrane proteins like yop1 can be challenging to extract in their native conformation. Optimization of extraction buffers with appropriate detergents is crucial for maintaining protein solubility and functionality.

How can researchers optimize culture conditions to enhance recombinant yop1 yield and quality?

Optimization of culture conditions is critical for maximizing both yield and functional quality of recombinant yop1:

  • Media composition:

    • Carbon source: Different carbon sources can significantly impact protein expression levels and glycosylation patterns

    • Nitrogen source: The type and concentration of nitrogen sources affect both growth and protein production

    • Trace elements: Appropriate concentrations of trace elements are essential for optimal fungal growth and protein synthesis

  • Physical parameters:

    • pH: Maintaining optimal pH prevents protein degradation by pH-dependent proteases

    • Temperature: Lower cultivation temperatures (25-28°C) often improve protein folding compared to higher temperatures

    • Aeration: Proper aeration (measured as volume of air per volume of liquid per minute, vvm) is critical for fungal growth and protein production

  • Induction timing and duration:

    • For inducible promoter systems like niaD or met3, optimization of induction timing relative to growth phase can significantly improve yields

    • Duration of induction periods should be optimized to balance maximum protein accumulation with minimal degradation

  • Harvest timing:

    • Monitoring protein expression over time to identify the optimal harvest point

    • For secreted proteins, analyzing protease activity in the culture medium at different time points

A systematic approach using design of experiments (DOE) methodology is recommended to efficiently identify optimal conditions while minimizing the number of experiments required.

What are potential applications of recombinant yop1 in studying membrane dynamics and organelle morphology?

Based on its sequence characteristics and probable membrane association, recombinant yop1 could serve as a valuable tool in several research applications:

  • Membrane curvature studies: Purified yop1 could be used in in vitro membrane reconstitution experiments to study its potential role in inducing or stabilizing membrane curvature.

  • Organelle morphology research: The protein could serve as a marker for specific membrane domains or be used to manipulate membrane structures in vivo when overexpressed or depleted.

  • Protein-lipid interaction studies: Recombinant yop1 could be utilized to investigate specific lipid preferences and how these interactions influence membrane properties.

  • Comparative studies: The function of yop1 could be compared across different fungal species to understand evolutionary conservation of membrane regulation mechanisms.

  • Structural biology applications: Purified recombinant yop1 could be used for structural determination via X-ray crystallography or cryo-electron microscopy, providing insights into its mechanism of action.

Methodologically, these applications would require the protein to be produced in a functional form with appropriate post-translational modifications, which makes the choice of expression system particularly important.

How does recombinant yop1 research contribute to our understanding of filamentous fungal biology?

Research on recombinant yop1 has broader implications for understanding fundamental aspects of filamentous fungal biology:

  • Evolutionary biology: Comparative analysis of yop1 across fungal species can provide insights into the evolution of membrane organization systems. Many filamentous fungal genes, including those involved in membrane dynamics, do not have homologues in yeasts like Saccharomyces cerevisiae and Schizosaccharomyces pombe .

  • Developmental biology: Given that many developmental regulatory genes in A. nidulans cause growth inhibition when overexpressed , studying yop1's potential role in development could reveal novel regulatory mechanisms.

  • Cell biology: Understanding the role of yop1 in membrane organization contributes to our knowledge of how filamentous fungi maintain their complex cellular architecture, particularly the extensive membrane systems required for their filamentous growth.

  • Biotechnology applications: Insights from yop1 research could inform strategies for engineering filamentous fungi for improved protein production or cellular functions.

To advance this understanding, researchers could employ comparative genomics approaches, develop conditional expression systems for yop1 using inducible promoters like niaD or met3 , and utilize advanced imaging techniques to visualize the effects of yop1 manipulation on cellular structures.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.