Recombinant Emericella nidulans Vacuolar ATPase assembly integral membrane protein VMA21 (vma21)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Emericella nidulans Vacuolar ATPase Assembly Integral Membrane Protein VMA21 (vma21)

The recombinant Emericella nidulans vacuolar ATPase assembly integral membrane protein VMA21 (vma21) is a bioengineered version of the native fungal protein critical for the assembly of the vacuolar ATPase (V-ATPase), a proton-pumping complex essential for acidifying intracellular compartments . This recombinant protein is typically expressed in Escherichia coli with modifications such as N-terminal His-tagging for purification and solubility .

Recombinant Production

Recombinant VMA21 is commercially available as a lyophilized powder or in Tris-based buffer with 50% glycerol. Key production details include:

  • Sequence Coverage: Full-length (1–111 aa)

  • Purity: >95% (SDS-PAGE)

  • Storage: -20°C to -80°C; avoid repeated freeze-thaw cycles

Functional Validation

Studies in Saccharomyces cerevisiae and A. nidulans demonstrate that VMA21:

  • Chaperones V₀ Subunits: Prevents misfolding of ATP6V0 subunits during ER assembly .

  • Regulates Proton Pump Activity: Defects in VMA21 reduce lysosomal acidification, impairing protease activation and autophagy .

Disease Modeling

VMA21 deficiency in humans is linked to:

  • X-linked Myopathy with Excessive Autophagy (XMEA): Caused by hypomorphic VMA21 alleles, leading to elevated lysosomal pH, reduced mTORC1 signaling, and autolysosome accumulation .

  • Congenital Disorders of Glycosylation (CDG): Mutations in VMA21 impair V-ATPase assembly, causing hepatic steatosis and hypercholesterolemia .

Diagnostic and Therapeutic Tools

Recombinant VMA21 is used in:

  • ELISA Assays: For detecting anti-VMA21 antibodies or quantifying protein expression .

  • Biochemical Studies: To investigate V-ATPase assembly mechanisms and lysosomal dysfunction .

Comparative Analysis with Orthologs

OrganismVMA21 OrthologKey Functional RoleDisease Relevance
Homo sapiensVMA21V-ATPase assembly; lysosomal acidificationXMEA, CDG
S. cerevisiaeVma21pER retrieval and V₀ transportYeast vacuolar defects
A. nidulansVMA21Hyphal growth, conidiation, and V-ATPase functionFungal pathogenesis, biocontrol

Future Directions

Recombinant VMA21 provides a platform for:

  • Therapeutic Design: Targeting V-ATPase assembly to modulate autophagy in neurodegenerative diseases .

  • Fungal Research: Studying biocontrol mechanisms in E. nidulans against pathogens like Cercospora beticola .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
vma21; AN2975; Vacuolar ATPase assembly integral membrane protein vma21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)
Target Names
vma21
Target Protein Sequence
MATRRPGKSYADAAVPGSTPGETPSELSSDTSPAVPMHVIYKLIGFTIAMITTPVGMYFV SVTFGASTTVAGIIAAVMANIILFLYIYVAWQEDKEEREADAARRKGAKAQ
Uniprot No.

Target Background

Function

Essential for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) within the endoplasmic reticulum.

Database Links

KEGG: ani:AN2975.2

Protein Families
VMA21 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.

Q&A

What is VMA21 and what is its primary function in fungal cells?

VMA21 (Vacuolar Membrane ATPase 21) is an 8.5-kDa integral membrane protein that resides in the endoplasmic reticulum (ER) and plays a critical role in the assembly of the Vacuolar-type ATPase (V-ATPase) complex . The primary function of VMA21 is to facilitate the assembly of the integral membrane sector (V₀ region) of the V-ATPase in the ER before it is transported to other cellular compartments . V-ATPases are rotary proton pumps essential for acidification of numerous intracellular compartments in almost all eukaryotic cells, with the V₀ complex responsible for proton translocation across membranes . In fungi such as Saccharomyces cerevisiae, the VMA21 protein (Vma21p) is not itself a subunit of the purified V-ATPase complex but instead acts as an assembly factor that ensures proper biogenesis of this crucial enzyme complex . The protein's function is highly conserved across fungal species including both S. cerevisiae and Emericella nidulans (also known as Aspergillus nidulans), suggesting its fundamental importance in eukaryotic cell physiology.

How does the structure of VMA21 relate to its retention in the endoplasmic reticulum?

The retention of VMA21 in the endoplasmic reticulum is primarily attributed to a specific structural feature at its C-terminus: a dilysine motif . This dilysine motif functions as an ER retrieval signal that prevents the protein from being transported forward in the secretory pathway . Studies have demonstrated that mutation of these lysine residues abolishes the retention of Vma21p in the ER and results in its delivery to the vacuole, which is the default destination for yeast membrane proteins . The dilysine motif likely interacts with COPI coat proteins that mediate retrograde transport from the Golgi back to the ER, thus maintaining the steady-state localization of Vma21p in the ER membrane . This strategic localization is crucial for VMA21's function, as it enables the protein to participate in the assembly of the V₀ region of V-ATPase in the ER before the complex is transported to other cellular compartments such as the Golgi for subsequent association with the V₁ region . The structural details of how VMA21 interacts with V-ATPase components during assembly have been elucidated through electron cryomicroscopy, revealing specific interaction interfaces that facilitate proper complex formation .

What phenotypes are associated with VMA21 deficiency in fungal systems?

VMA21 deficiency in fungal systems leads to a constellation of phenotypes primarily related to defective V-ATPase function and improper pH homeostasis . In yeast vma21 mutants, the V-ATPase complex fails to assemble onto the vacuolar membrane, resulting in a characteristic "vma phenotype" . This phenotype includes inability to grow at neutral or alkaline pH, calcium sensitivity, and defects in various processes requiring vacuolar acidification . At the molecular level, vma21 mutants exhibit accumulation of peripheral V-ATPase subunits in the cytosol, while the 100-kDa integral membrane subunit is rapidly degraded by non-vacuolar proteases . The failure to assemble the V-ATPase complex in vma21 mutants underscores the essential role of VMA21 in V-ATPase biogenesis and subsequent cellular pH regulation . These phenotypic manifestations of VMA21 deficiency provide valuable experimental readouts for researchers studying VMA21 function in various fungal species including E. nidulans. The conservation of these phenotypes across fungal species suggests that the fundamental role of VMA21 in V-ATPase assembly is evolutionarily preserved, though species-specific variations in phenotypic severity may occur due to differences in genetic redundancy or compensatory mechanisms.

How does E. nidulans VMA21 differ from its S. cerevisiae homolog in structure and function?

The VMA21 protein in Emericella nidulans (also known as Aspergillus nidulans) shares fundamental functional similarities with its Saccharomyces cerevisiae counterpart, but exhibits notable differences that reflect evolutionary divergence and adaptation to different cellular environments . While both proteins function in V-ATPase assembly, the E. nidulans VMA21 operates within the context of a more complex genome with 666 genes linked to metabolic roles, as compared to the relatively streamlined S. cerevisiae genome . Structural analysis suggests that the E. nidulans VMA21 maintains the core transmembrane domains and the critical C-terminal dilysine motif for ER retention, but may possess additional regulatory elements that integrate with the filamentous fungus's more elaborate cellular compartmentalization and developmental stages . Unlike S. cerevisiae, E. nidulans undergoes complex morphological transitions during its life cycle, potentially requiring additional regulatory control over V-ATPase assembly that may be reflected in VMA21 structure or interactome . These differences may explain why E. nidulans has been recognized as a treasure trove of specialized metabolites with a wide array of biological activities, suggesting that proper V-ATPase function supported by VMA21 may be integral to specialized metabolite production or compartmentalization .

What methods are most effective for studying VMA21-dependent V-ATPase assembly in E. nidulans?

Studying VMA21-dependent V-ATPase assembly in Emericella nidulans requires a multidisciplinary approach combining genetic, biochemical, and structural methodologies tailored to this filamentous fungus . Genome-scale analysis methods have proven particularly valuable, with manually assigned functions to 472 orphan genes in E. nidulans metabolism providing a foundation for understanding the broader metabolic context in which VMA21 operates . Cryo-electron microscopy has emerged as a powerful technique for elucidating the structural basis of V-ATPase assembly, revealing how assembly factors like VMA21 coordinate with other proteins such as Vma12p and Vma22p to ensure proper complex formation . For functional studies, the development of a mathematical model of E. nidulans metabolism incorporating 1213 metabolic reactions (1095 biochemical transformations and 118 transport processes) offers a systems-level framework for interpreting the consequences of VMA21 perturbation . This model can be particularly useful when analyzing transcriptome data from VMA21 mutants, as demonstrated by similar approaches used for studying regulatory gene deletions like creA . Integration of these diverse methodologies, combined with the powerful genetic tractability of E. nidulans, enables researchers to comprehensively characterize VMA21's role in V-ATPase assembly and subsequent impacts on cellular physiology and specialized metabolism.

How do mutations in the dilysine motif of E. nidulans VMA21 affect its subcellular localization and function?

Mutations in the dilysine motif of E. nidulans VMA21 significantly alter its subcellular localization and consequently impair its function in V-ATPase assembly . The dilysine motif at the carboxy terminus of VMA21 serves as an ER retrieval signal, and its mutation abolishes retention in the endoplasmic reticulum . When these lysine residues are altered, the protein escapes ER retention and is instead delivered to the vacuole, which represents the default destination for membrane proteins in fungal systems . This mislocalization has profound functional consequences, as VMA21 must be present in the ER to facilitate the assembly of the V₀ region of the V-ATPase . Without proper ER localization, VMA21 cannot perform its essential role in V-ATPase biogenesis, leading to defective proton pump assembly and function . Research suggests that in E. nidulans, as in other fungi, this mislocalization would result in failure to acidify various cellular compartments, compromising numerous pH-dependent cellular processes and potentially disrupting the production of specialized metabolites for which E. nidulans is known . The study of dilysine motif mutations thus provides a valuable experimental approach for dissecting the relationship between VMA21 localization and function in the context of V-ATPase assembly and broader cellular physiology.

What expression systems are optimal for producing recombinant E. nidulans VMA21 protein?

The expression of recombinant E. nidulans VMA21 protein presents significant challenges due to its integral membrane nature and its relatively small size of approximately 8.5 kDa . Based on studies with homologous proteins, heterologous expression in Saccharomyces cerevisiae offers distinct advantages, particularly for functional studies, as it provides a eukaryotic environment with appropriate post-translational modification machinery and membrane insertion systems . For structural studies requiring higher protein yields, insect cell expression systems using baculovirus vectors have proven effective for V-ATPase components, likely extending to VMA21 . Escherichia coli expression systems may be employed for specific applications, but often require fusion partners to enhance stability and solubility, such as maltose-binding protein (MBP) or thioredoxin . When expressing in bacterial systems, it's crucial to optimize codon usage for E. nidulans genes, as fungal codon preferences differ significantly from bacterial ones . For all expression systems, incorporating affinity tags (such as polyhistidine or FLAG tags) positioned to avoid interference with the C-terminal dilysine motif is recommended, as this motif is critical for ER retention and proper function . Careful selection of detergents for membrane protein extraction represents another crucial consideration, with mild detergents like digitonin or n-dodecyl-β-D-maltoside (DDM) often proving most effective for maintaining native conformations of membrane proteins like VMA21.

How can researchers effectively detect and quantify VMA21 protein in E. nidulans samples?

Effective detection and quantification of VMA21 protein in E. nidulans samples requires specialized approaches that address the challenges associated with studying small integral membrane proteins . Immunological methods represent a primary approach, with western blotting using antibodies raised against species-specific VMA21 epitopes or against engineered epitope tags (such as HA, Myc, or FLAG) . For enhanced sensitivity and specificity, a sandwich ELISA system can be developed using polyclonal antibodies against VMA21 for capture and monoclonal antibodies for detection . Fluorescent protein fusions (such as GFP or mCherry) enable visualization of VMA21 subcellular localization through confocal microscopy, though care must be taken to ensure the fusion does not disrupt the critical C-terminal dilysine motif . Mass spectrometry-based approaches, particularly selected reaction monitoring (SRM) or parallel reaction monitoring (PRM), offer high sensitivity for absolute quantification of low-abundance proteins like VMA21 in complex samples . For functional assessment, complementation assays in S. cerevisiae vma21 mutants provide a robust readout of E. nidulans VMA21 activity, allowing for both qualitative and semi-quantitative evaluation based on restoration of growth under stress conditions . When combined, these approaches enable comprehensive characterization of VMA21 expression, localization, and function in E. nidulans experimental systems.

What techniques can visualize the interactions between VMA21 and other components of the V-ATPase assembly machinery?

Visualizing interactions between VMA21 and other components of the V-ATPase assembly machinery requires sophisticated techniques that can capture both transient and stable protein associations in membrane environments . Cryo-electron microscopy (cryo-EM) has emerged as a revolutionary technique for elucidating these interactions at near-atomic resolution, as demonstrated by recent structures of V-ATPase V₀ region assembly complexes containing Vma12p, Vma21p, and Vma22p . This approach has revealed how these assembly factors work together to facilitate V-ATPase biogenesis while preventing premature activation of proton pumping . Complementary to structural approaches, fluorescence-based techniques offer dynamic insights into protein-protein interactions in living cells . Bimolecular fluorescence complementation (BiFC), where VMA21 and potential interaction partners are fused to complementary fragments of a fluorescent protein, can visualize associations in their native subcellular context . Förster resonance energy transfer (FRET) between appropriately tagged proteins provides another powerful approach for detecting interactions with nanometer-scale sensitivity . For broader interactome mapping, proximity-dependent biotin labeling approaches (BioID or TurboID) with VMA21 as the bait protein can identify both stable and transient interaction partners in the cellular environment . Cross-linking mass spectrometry (XL-MS) offers additional advantages for capturing specific interaction interfaces between VMA21 and other assembly factors or V-ATPase subunits . Integration of these diverse visualization techniques provides a comprehensive understanding of how VMA21 orchestrates V-ATPase assembly through multiple protein-protein interactions.

How conserved is VMA21 structure and function between fungi and higher eukaryotes?

The structure and function of VMA21 demonstrate remarkable conservation across evolutionary distance, from fungi to higher eukaryotes, underscoring its fundamental importance in V-ATPase assembly and cellular pH homeostasis . At the sequence level, VMA21 proteins maintain key structural features across species, particularly the transmembrane domains and the critical C-terminal dilysine motif responsible for ER retention . This conservation extends to functional roles, as demonstrated by studies showing that human VMA21 mutations cause X-linked Myopathy with Excessive Autophagy (XMEA), a disorder characterized by defective V-ATPase assembly similar to that observed in fungal vma21 mutants . The structural basis for V-ATPase V₀ region assembly by VMA21 and associated factors (Vma12p/TMEM199 and Vma22p/CCDC115 in fungi/humans, respectively) appears largely preserved across evolution, with cryo-EM studies revealing conserved interaction interfaces that facilitate proper complex formation . Despite this conservation, species-specific adaptations exist, particularly in regulatory mechanisms that may reflect differences in cellular organization and physiology between fungi like E. nidulans and more complex eukaryotes . These evolutionary insights provide valuable context for interpreting the relevance of fungal VMA21 studies to human health and disease, while also highlighting the power of model organisms for understanding fundamental aspects of V-ATPase biology.

What can comparative genomics reveal about VMA21 evolution and adaptation?

Comparative genomics analyses of VMA21 across diverse fungal species and higher eukaryotes reveal fascinating patterns of evolutionary conservation and adaptation that reflect the protein's essential role in cellular physiology . By comparing VMA21 sequences across the fungal kingdom, researchers have identified highly conserved domains likely representing functional constraints, particularly the transmembrane regions and the ER retention motif . The genome-scale analysis of A. nidulans metabolism, which has manually assigned functions to 472 orphan genes, provides a valuable framework for understanding how VMA21 has co-evolved with other components of the V-ATPase assembly machinery and related metabolic pathways . Interestingly, comparative genomics reveals that while VMA21's core function in V-ATPase assembly is preserved across species, its regulatory context varies considerably, potentially reflecting adaptations to different cellular environments and metabolic requirements . In E. nidulans, which produces a diverse array of specialized metabolites, VMA21 may have evolved specific features that support the compartmentalization and regulation of these metabolic pathways . The integration of comparative genomics with structural and functional data provides a powerful approach for dissecting the evolutionary history of VMA21 and predicting how sequence variations might impact function across different species or in disease-associated mutations .

What are the functional implications of species-specific differences in VMA21 between S. cerevisiae and E. nidulans?

The species-specific differences in VMA21 between Saccharomyces cerevisiae and Emericella nidulans have significant functional implications that reflect the distinct cellular physiologies and ecological niches of these fungi . While both proteins share the core function of facilitating V-ATPase assembly, E. nidulans VMA21 operates within a more complex metabolic network comprising 1213 metabolic reactions and 732 balanced metabolites, compared to the simpler metabolic landscape of S. cerevisiae . This expanded metabolic context in E. nidulans likely influences both the regulation and function of VMA21, potentially requiring additional protein-protein interactions or regulatory mechanisms . E. nidulans produces a diverse array of specialized metabolites, including polyketides, alkaloids, and peptides with various biological activities, many of which require proper compartmentalization and pH regulation for biosynthesis . The VMA21-dependent V-ATPase activity may therefore play a critical role in supporting this specialized metabolism, representing a functional adaptation not required in S. cerevisiae . The filamentous growth habit and complex developmental lifecycle of E. nidulans, involving both asexual and sexual reproduction, may also impose unique requirements on VMA21 function that differ from those in unicellular S. cerevisiae . Understanding these species-specific functional adaptations provides valuable insights into how conserved cellular machinery can be modulated to support diverse physiological requirements across the fungal kingdom.

What are the most effective gene editing strategies for studying VMA21 function in E. nidulans?

The genetic manipulation of VMA21 in Emericella nidulans requires carefully designed strategies that account for both the essential nature of this gene and the specific characteristics of this filamentous fungus . CRISPR-Cas9 approaches have emerged as powerful tools for precise gene editing in E. nidulans, offering advantages over traditional homologous recombination methods in terms of efficiency and specificity . When designing guide RNAs for VMA21 targeting, researchers should avoid the C-terminal region containing the critical dilysine motif to prevent unintended functional disruption when introducing tags or mutations . For studying VMA21 function, conditional expression systems such as the alcohol-inducible alcA promoter or the tet-on/off system enable tight control over VMA21 expression, allowing for temporal studies of V-ATPase assembly dynamics . Site-directed mutagenesis approaches targeting specific residues, particularly within transmembrane domains or the dilysine motif, can provide valuable structure-function insights when combined with appropriate phenotypic readouts . The integration of these genetic manipulations with the mathematical model of E. nidulans metabolism offers a powerful framework for interpreting the broader metabolic consequences of VMA21 perturbation . Gene replacement strategies using heterologous VMA21 genes from other species, including S. cerevisiae or human VMA21, can reveal the extent of functional conservation and species-specific adaptations through complementation analysis .

How can researchers establish reliable functional assays for E. nidulans VMA21 activity?

Establishing reliable functional assays for E. nidulans VMA21 activity requires a multifaceted approach that addresses both direct measures of protein function and downstream physiological consequences . V-ATPase assembly assays represent a primary readout of VMA21 function, typically involving subcellular fractionation followed by western blotting or co-immunoprecipitation to assess the proper assembly of V₀ and V₁ sectors . Vacuolar pH measurements using ratiometric fluorescent probes such as BCECF-AM or pHluorin provide a functional readout of V-ATPase activity dependent on proper VMA21-mediated assembly . Growth phenotype assays under challenging conditions—such as alkaline pH, elevated calcium, or in the presence of metal ions—offer straightforward readouts that correlate with V-ATPase function . For more sophisticated analysis, metabolomic profiling using liquid chromatography-mass spectrometry can detect changes in specialized metabolite production that may result from altered compartment acidification in VMA21 mutants . The integration of these assays with the comprehensive mathematical model of E. nidulans metabolism provides a systems-level framework for interpreting functional data . Additionally, heterologous complementation in S. cerevisiae vma21 mutants offers a robust platform for assessing the functional capacity of E. nidulans VMA21 variants, taking advantage of the well-characterized vma phenotypes in yeast .

What approaches can identify novel interaction partners of VMA21 in E. nidulans?

Identification of novel interaction partners of VMA21 in Emericella nidulans requires specialized approaches that can capture both stable and transient interactions in the challenging context of a membrane protein environment . Affinity purification coupled with mass spectrometry (AP-MS) using epitope-tagged VMA21 as bait represents a foundational approach, though careful optimization of detergent conditions is crucial for maintaining native interactions during membrane protein extraction . Proximity-dependent labeling methods such as BioID or TurboID, where a biotin ligase is fused to VMA21, enable identification of proteins in the native cellular environment without requiring stable interactions, making them particularly valuable for detecting transient assembly intermediates . Two-hybrid systems adapted for membrane proteins, such as split-ubiquitin or MYTH (Membrane Yeast Two-Hybrid), can systematically screen for binary interactions between VMA21 and potential partners . Genome-wide genetic interaction screens, using synthetic lethality or synthetic sickness as readouts, can identify functional relationships even in the absence of physical interactions . Cross-linking mass spectrometry (XL-MS) offers the additional advantage of capturing specific interaction interfaces, providing structural insights alongside interaction data . The integration of these diverse approaches with the mathematical model of E. nidulans metabolism can contextualize newly identified interactions within the broader cellular physiology . When combined with comparative analyses across fungal species, these approaches have the potential to reveal both conserved core interaction networks and species-specific adaptations in VMA21 function.

How should researchers interpret conflicting data regarding VMA21 localization or function?

When confronted with conflicting data regarding VMA21 localization or function, researchers should implement a systematic troubleshooting approach that considers multiple experimental variables and biological complexities . Subcellular localization discrepancies may arise from differences in experimental conditions, with factors such as growth phase, media composition, or environmental stressors potentially influencing VMA21 distribution between the ER and other compartments . Tag selection and positioning represent another critical variable, as C-terminal tags may interfere with the dilysine motif essential for ER retention, leading to artificial mislocalization . Functional contradictions may reflect differences in assay sensitivity or specificity, with direct biochemical measures of V-ATPase assembly sometimes yielding different results than phenotypic growth assays . Species-specific differences between E. nidulans and model organisms like S. cerevisiae could also explain apparent inconsistencies, as the more complex metabolic network and developmental program of E. nidulans may modify VMA21 regulation or function . Statistical analysis of quantitative data using appropriate tests and sufficient biological replicates is essential for determining whether apparent contradictions represent genuine biological phenomena or experimental artifacts . When conflicts persist despite rigorous analysis, computational modeling approaches using the mathematical framework of E. nidulans metabolism can generate testable hypotheses to resolve apparent contradictions . This systematic approach to data interpretation ensures that conflicting results serve as opportunities for deeper understanding rather than obstacles to progress.

How can researchers design experiments to distinguish between direct and indirect effects of VMA21 manipulation?

Distinguishing between direct and indirect effects of VMA21 manipulation requires carefully designed experimental strategies that can disentangle the immediate consequences of altered VMA21 function from downstream metabolic or physiological adaptations . Time-resolved approaches using conditional expression systems (such as tet-on/off or alcA promoters) enable researchers to track the temporal sequence of events following VMA21 perturbation, with rapid changes likely representing direct effects and delayed responses suggesting indirect consequences . Specific domain mutations or chimeric constructs that selectively disrupt particular VMA21 functions while preserving others can help isolate direct effects on V-ATPase assembly from broader cellular impacts . Metabolic flux analysis using isotope-labeled precursors provides a powerful approach for distinguishing primary metabolic alterations from compensatory responses following VMA21 manipulation . Genetic suppressor screens can identify genes that when mutated compensate for VMA21 dysfunction, helping to map direct functional pathways connected to VMA21 activity . Comparative studies across multiple fungal species with different metabolic architectures but conserved VMA21 function can reveal which phenotypes represent direct consequences of impaired V-ATPase assembly versus species-specific indirect effects . Integration of experimental data with the mathematical model of E. nidulans metabolism enables in silico prediction of direct versus indirect effects through flux balance analysis and metabolic network perturbation . This multifaceted approach ensures that researchers can confidently attribute observed phenotypes to the appropriate mechanistic level, advancing our understanding of VMA21's precise role in cellular physiology.

What are the most significant remaining questions about E. nidulans VMA21?

Despite significant advances in our understanding of VMA21 structure and function, several critical questions remain unanswered regarding the E. nidulans homolog specifically . The precise structural differences between E. nidulans VMA21 and its S. cerevisiae counterpart have not been fully characterized, leaving open questions about potential adaptations that might support the more complex metabolism and development of this filamentous fungus . The regulatory mechanisms controlling VMA21 expression in E. nidulans remain poorly understood, particularly in the context of its developmental lifecycle and specialized metabolite production . The potential role of E. nidulans VMA21 in supporting the biosynthesis and compartmentalization of its diverse array of bioactive compounds—including polyketides, alkaloids, and peptides—represents a significant knowledge gap at the intersection of cell biology and natural product chemistry . Whether E. nidulans contains additional assembly factors that cooperate with VMA21 or possesses compensatory mechanisms for V-ATPase assembly that might not exist in other fungi remains unresolved . The potential role of VMA21 in mediating stress responses or adaptation to environmental conditions specific to E. nidulans ecological niches represents another area requiring further investigation . The integration of VMA21 function within the broader context of the 1213 metabolic reactions and 732 metabolites mapped in E. nidulans presents opportunities for systems-level analysis that has yet to be fully exploited . Addressing these questions will require innovative approaches combining structural biology, genetics, metabolomics, and computational modeling, ultimately advancing our understanding of this fundamentally important protein in a significant model organism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.