Recombinant Emerin homolog 1 (emr-1)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
emr-1; M01D7.6; Emerin homolog 1; Ce-emerin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
emr-1
Target Protein Sequence
MDVSQLTDAELRDSLKSHGVSVGPIVATTRKLYEKKLIKLSDGSINNQSNLNDSQFNEDS
LIISSSPKKSPPQRVFQNVSAATAAATTSPESDSDDCEESMRYLTEEEMAADRASARQAQ
SNKGGFLGSTITFTILFVFIAVFAYFLIENAEQLKLVAETNPEDTI
Uniprot No.
Target Background
Function
Recombinant Emerin homolog 1 (emr-1) is involved in chromosome segregation and cell division, likely through interaction with laminin-1 (lmn-1), a major nuclear lamina component. It exhibits functional overlap with LEM-2 and may play a role in the cellular response to radiation-induced DNA damage.
Gene References Into Functions
- A study demonstrated a specific role of EMR-1 in neuromuscular junction activity, potentially contributing to human Emery-Dreifuss muscular dystrophy. PMID: 24490688
- Research indicates that Ce-emerin and LEM-2 have additional roles in various tissues, including striated and smooth muscle. PMID: 22171324
- Studies revealed that LEM domain proteins are crucial for cell division, and Ce-emerin and Ce-MAN1 share overlapping functions, potentially relevant to Emery-Dreifuss muscular dystrophy. PMID: 12684533
Database Links
Subcellular Location
Nucleus envelope. Nucleus inner membrane; Single-pass membrane protein; Nucleoplasmic side.
Tissue Specificity
Ubiquitous. Expressed in all cells, except in cells undergoing spermatogenesis.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
