Recombinant Encephalitozoon cuniculi Aquaporin (AQP)

Shipped with Ice Packs
In Stock

Description

Water Permeability

EcAQP exhibits high water permeability (P<sub>f</sub> values comparable to other parasitic AQPs) when expressed in Xenopus laevis oocytes . Functional assays demonstrate:

  • Water Selectivity: No permeability to glycerol or urea .

  • Mercury Insensitivity: Unlike human AQPs, EcAQP retains activity after HgCl<sub>2</sub> treatment .

Pathogen Biology

EcAQP is essential for E. cuniculi spore germination, a critical step in infection. Its study aids in understanding microsporidian life cycles and developing targeted therapies .

Therapeutic Potential

  • Inhibitor Screening: Mercury-resistant properties suggest alternative inhibitors (e.g., gold/silver salts) may disrupt EcAQP function .

  • Structural Studies: Recombinant EcAQP facilitates crystallization and cryo-EM analysis for drug design .

EcAQP differs from AQPs in other pathogens in substrate specificity and inhibitor resistance:

AQPOrganismWater PermeabilityGlycerol TransportMercury Sensitivity
EcAQPE. cuniculiHighNoNo
PfAQPP. falciparumHighYesYes
TgAQPT. gondiiModerateNoYes

Data compiled from

Future Directions

  • Drug Development: Exploring EcAQP-specific inhibitors for microsporidian infections.

  • Structural Biology: Resolving EcAQP’s 3D structure to elucidate mercury resistance mechanisms.

  • Comparative Genomics: Identifying homologs in other microsporidia (e.g., Nosema ceranae) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
AQP; ECU07_0740; Aquaporin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Encephalitozoon cuniculi (strain GB-M1) (Microsporidian parasite)
Target Names
AQP
Target Protein Sequence
MTRETLKTLQSTFGEMVASFVFGFAVYSALLGSALTEQSAARVIVGLTVGFSGICVIYSFCDVTVAHFNPAITLAAILTCKLGVLRGIGYIVAQYIGFILAVCALLPCSPVGYKETLNIIRPTPSPFGGDNLNVFFTEFFLTAILVHVAFATAVNPYKPKTDTEGKFVDPDEEEPVDRRITAPLCIGLTLGFLAFLGLASSGGAFNPGLTLAPVIMSNTWNHFWAYFAGQYLGGFVGGLLQVLVLYKLSF
Uniprot No.

Target Background

Function
Aquaporins are water channels that facilitate water transport across cell membranes. They play a crucial role in osmotolerance.
Database Links
Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of the EcAQP gene in E. cuniculi?

The EcAQP gene is present as a single AQP-like sequence within the approximately 2.8-Mb genome of Encephalitozoon cuniculi. This gene was identified during genome sequencing and annotation efforts, with the GenBank accession number NP_586002. The gene is positioned within the genome's restriction map, which has been constructed using two restriction enzymes with 6 bp recognition sites (BssHII and MluI) . The complete E. cuniculi genome has relatively small chromosomes with an average distance between successive restriction sites of approximately 19 kb .

What is the recommended protocol for cloning and expressing recombinant EcAQP?

The established methodology for cloning and expressing EcAQP involves:

  • Extraction of E. cuniculi genomic DNA using SDS and proteinase K treatment followed by phenol-chloroform extraction .

  • PCR amplification with specific primers containing engineered restriction sites (XmaI and XbaI) for directional cloning:

    • Forward primer: 5′-GGACCTCCCGGGATGACCAGAGAGACATTGAAG-3′

    • Reverse primer: 5′-GACCCTCTAGACTAAAAGCTGAGCTTGTACAG-3′

  • PCR conditions: 35 cycles of 45s denaturation at 94°C, 45s annealing at 40°C, and 60s extension at 60°C using Pfx DNA polymerase .

  • Cloning the amplicon into an appropriate expression vector compatible with the Xenopus oocyte expression system .

  • In vitro transcription to generate cRNA for oocyte injection.

This approach yields functional recombinant EcAQP that can be readily assessed in subsequent experimental assays.

What functional assays are most effective for characterizing recombinant EcAQP activity?

The gold standard for functional characterization of EcAQP is the Xenopus oocyte swelling assay, which directly measures osmotic water permeability. The methodology involves:

  • Injection of EcAQP cRNA into defolliculated Xenopus oocytes.

  • Incubation for 3-4 days to allow protein expression.

  • Transfer of oocytes from isotonic solution (200 mOsm) to hypotonic solution (70 mOsm).

  • Video microscopy to record oocyte swelling over time.

  • Calculation of the osmotic water permeability coefficient (Pf) using the formula:

    Pf = [V0 × d(V/V0)/dt]/[S × Vw × (Osmin - Osmout)]

    where V0 is the initial oocyte volume, S is the oocyte surface area, Vw is the molar volume of water, and Osmin - Osmout is the osmotic gradient .

For EcAQP-expressing oocytes, the measured Pf value is substantially higher than water-injected control oocytes, confirming water channel activity. Additional assays should include testing for permeability to other solutes such as glycerol and urea, which EcAQP does not transport .

How can researchers assess the mercury sensitivity of EcAQP and what does this reveal about its structure?

To assess mercury sensitivity of EcAQP:

  • Pre-incubate EcAQP-expressing oocytes with 1 mM HgCl2 for 5 minutes.

  • Perform the standard swelling assay in hypotonic solution.

  • Compare Pf values between mercury-treated and untreated oocytes.

Unlike classical aquaporins such as AQP1, EcAQP-expressing oocytes demonstrate no inhibition of water permeability when treated with HgCl2 . This mercury insensitivity correlates with sequence analysis revealing the absence of the critical cysteine residue near the second NPA motif (equivalent to C189 in AQP1) that confers mercury sensitivity . For comparison, other known mercury-insensitive aquaporins include mammalian AQP4 . This characteristic provides insights into the evolutionary divergence of EcAQP and may inform structure-function relationships in the aquaporin family.

How does the osmotic water permeability of EcAQP compare to aquaporins from other parasitic organisms?

The table below summarizes the osmotic water permeability coefficients (Pf) of aquaporins from various parasitic protists measured using the Xenopus oocyte expression system:

OrganismAquaporinPf (μm/s)Reference
Encephalitozoon cuniculiEcAQP~40-50*
Toxoplasma gondiiTgAQP40
Trypanosoma cruziTcAQP32
Plasmodium falciparumPfAQP276

*Estimated from comparative data in the research papers

The Pf value of EcAQP falls within the moderate range compared to other parasitic aquaporins, being similar to TgAQP from Toxoplasma gondii but substantially lower than PfAQP from Plasmodium falciparum . These comparative values suggest evolutionary adaptations that may correlate with the specific water requirements during different parasite life cycles.

What structural features distinguish EcAQP from other microsporidia aquaporins?

  • EcAQP functions strictly as a water channel (orthodox aquaporin) with no measurable permeability to glycerol or urea, unlike some other parasitic aquaporins that function as aquaglyceroporins .

  • EcAQP lacks the mercury-sensitive cysteine residue near the NPA motifs, making it inherently resistant to mercury inhibition .

  • Sequence alignment shows moderate identity (24-26%) with aquaporins from evolutionarily distant organisms such as Dictyostelium discoideum and humans .

Further structural comparisons would require identification and characterization of aquaporins from other microsporidian species, which represents an important direction for future research.

What evidence suggests that EcAQP is involved in the infectious process of E. cuniculi?

Multiple lines of evidence support EcAQP's role in E. cuniculi infection:

  • The infectious process of microsporidia is dependent upon the rapid influx of water into spores, a process believed to be mediated by aquaporins .

  • Functional characterization confirms that EcAQP facilitates rapid water transport when expressed in Xenopus oocytes, with significantly higher water permeability compared to controls .

  • Germination of Brachiola (Nosema) algerae spores (another microsporidian) is inhibitable by mercury salts, suggesting the involvement of aquaporins in this critical step of infection .

  • The presence of a single AQP-like sequence in the E. cuniculi genome indicates its potential importance for parasite survival and propagation .

These findings collectively suggest that EcAQP plays a crucial role in the E. cuniculi infectious cycle, particularly during the germination process when rapid water influx is required for polar tube extrusion.

How might EcAQP contribute to pathogenesis in human microsporidiosis?

EcAQP likely contributes to E. cuniculi pathogenesis through several mechanisms:

  • Facilitation of spore germination: By enabling rapid water influx, EcAQP likely powers the internal pressure increase necessary for polar tube extrusion, a critical step in host cell invasion .

  • Adaptation to host environments: EcAQP may help regulate parasite osmotic balance within different host cell types and tissues.

  • Resistance to inhibition: The mercury-insensitivity of EcAQP suggests evolutionary adaptation that may protect this crucial function from certain host defense mechanisms or environmental factors .

Recent clinical data indicates that E. cuniculi infections occur in patients with various conditions, including degenerative hip and knee disease , highlighting the diverse pathogenic contexts in which EcAQP may function.

What potential inhibitors could target EcAQP for therapeutic development?

While EcAQP is insensitive to mercury compounds, several alternative inhibitor classes could be explored:

  • Heavy metal compounds: Although HgCl2 does not inhibit EcAQP, other heavy metals such as gold and silver salts have been reported to inhibit certain mercury-insensitive aquaporins and could be investigated as potential EcAQP inhibitors .

  • Small molecule inhibitors: Rational drug design based on the predicted structure of EcAQP could yield novel inhibitors that specifically target unique structural features of this aquaporin.

  • Peptide inhibitors: Designed peptides that mimic or interact with functional domains of EcAQP might disrupt its water transport function.

Screening approaches should incorporate the established Xenopus oocyte swelling assay to identify compounds that reduce EcAQP-mediated water permeability . Candidate inhibitors could then be tested for their ability to prevent E. cuniculi spore germination and host cell infection in vitro.

How can genomic data from E. cuniculi strains enhance our understanding of EcAQP evolution?

Analysis of genomic data from different E. cuniculi strains can provide valuable insights into EcAQP evolution:

  • Examination of restriction fragment length polymorphisms in the EcAQP gene region across strains can reveal genetic variations that might affect EcAQP function .

  • Evidence from restriction mapping and molecular combing experiments has confirmed that E. cuniculi is diploid, with some chromosomes showing size polymorphisms due to deletion/insertion events . Similar analysis focused on the EcAQP locus could reveal evolutionary pressures on this gene.

  • Comparative analysis between E. cuniculi and other microsporidia species could identify conserved regions of EcAQP that are essential for function versus regions that have diverged due to host-specific adaptations.

The physical map of the E. cuniculi genome, constructed using restriction enzymes with average spacing of 19 kb, provides an essential framework for positioning the EcAQP gene relative to other genetic elements . This contextual information can further inform evolutionary analyses.

What challenges exist in developing heterologous expression systems for structural studies of EcAQP?

Several challenges must be addressed for successful structural characterization of EcAQP:

  • Membrane protein expression: Like other aquaporins, EcAQP is a transmembrane protein that requires appropriate membrane integration for proper folding and function.

  • Post-translational modifications: Any potential post-translational modifications in native EcAQP must be replicated in heterologous systems or their absence accounted for in structural analyses.

  • Protein stability: Identifying conditions that maintain EcAQP stability during purification and crystallization presents significant challenges.

  • Crystallization barriers: Membrane proteins like EcAQP are notoriously difficult to crystallize due to their hydrophobic surfaces and conformational flexibility.

Potential approaches to overcome these challenges include:

  • Using specialized expression systems designed for membrane proteins

  • Engineering fusion constructs with stabilizing partners

  • Employing lipidic cubic phase crystallization methods

  • Exploring cryo-electron microscopy as an alternative to crystallography

How might understanding EcAQP function inform broader microsporidia research?

Comprehensive characterization of EcAQP provides a foundation for understanding water transport mechanisms across microsporidia, with several important implications:

  • EcAQP's role in spore germination represents a potential vulnerability that could be exploited for therapeutic intervention against multiple microsporidian pathogens .

  • The unique structural features of EcAQP, such as mercury insensitivity, suggest evolutionary adaptations that may be common across microsporidian aquaporins .

  • Functional studies of EcAQP provide a methodological framework that can be applied to aquaporins from other microsporidian species.

Future research should extend beyond E. cuniculi to examine aquaporins in other clinically relevant microsporidia, potentially revealing conserved mechanisms that could serve as broad-spectrum therapeutic targets.

What collaborative approaches would accelerate EcAQP research?

Interdisciplinary collaboration would significantly advance EcAQP research:

  • Structural biologists and biochemists: For detailed structural characterization using X-ray crystallography, cryo-EM, or NMR spectroscopy.

  • Medicinal chemists: To design and synthesize potential inhibitors based on structural insights.

  • Cell biologists: To investigate the precise localization and dynamics of EcAQP during the E. cuniculi life cycle.

  • Computational biologists: For in silico modeling of EcAQP structure, dynamics, and interactions with potential inhibitors.

  • Clinical microbiologists: To evaluate the relevance of EcAQP-targeted approaches in clinical isolates from infected patients .

Shared resources, such as recombinant protein expression systems, structural data, and inhibitor libraries, would facilitate rapid progress in understanding and targeting EcAQP for therapeutic development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.