Recombinant Encephalitozoon cuniculi Probable ABC transporter ECU01_0200/ECU01_1410 (ECU01_0200)

Shipped with Ice Packs
In Stock

Description

Overview

Encephalitozoon cuniculi is an obligate intracellular eukaryotic parasite that falls under the class Microsporidia and is considered a highly derived fungus . It can infect all mammalian species, with rabbits, guinea pigs, and mice being primary reservoirs . In humans, it is often associated with severe immunodeficiency, such as in HIV patients or transplant recipients . E. cuniculi is transmitted through the ingestion of infective spores shed in urine or, in rabbits, through inhalation, and vertical transmission has been documented in rabbits and suspected in guinea pigs .

The "Recombinant Full Length Encephalitozoon cuniculi Probable ABC transporter ECU01_0200/ECU01_1410(ECU01_0200) Protein, His-Tagged" is a recombinant protein expressed in E. coli, with a His tag attached to the N-terminal . It is derived from the Encephalitozoon cuniculi probable ABC transporter ECU01_0200/ECU01_1410, and it is available as a lyophilized powder .

Characteristics

CharacteristicDescription
SpeciesEncephalitozoon cuniculi
SourceE. coli
TagHis tag
Protein LengthFull Length (1-596 amino acids)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, avoid repeated freeze-thaw cycles
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Gene NameECU01_0200
SynonymsECU01_0200; ECU01_1410; Probable ABC transporter ECU01_0200/ECU01_1410
UniProt IDQ8SQI5
AA SequenceMRRMDRWTVCRRLASMARPVSFLEAALMAVVAACIVLGKWFDVMSIKRRGLIINGLKDIKGMGSANVSSIYGDAAAFLVLRTLSSAFTESKAILFSAVTNRVVQASTSRILDLTMHAAHSCEIKPTELNRIVERGNRKISKVLVKTLTVATPALFRLALLFREVHAMFGPKYLVPILFTAAAYAAYTCVMLRIRARYRKEINNADNSVSRRIHECVSNVDLVRACCSEQFEVSRLAGEMETMWALKLSDKGCVGMTNLGQRALFSVLFVHVAFKGIADMAALRMTVGDLSVLFSFVLSIDASMWTLGGIARDLGFWLTDCTDLLCLHDGLERAAEQGPGAGAAAEGMAACPSSPPGEAAAVEFDDVSFAYPRSAAYPRSAHVLSGVSFRIMRGERVGIIGRPGSGKSTILRLILMLHRHKGRIRVNGAELWSASPRAVRGSIGCILQDGLLFDESILYNVMYGCPRAGFHRVLRECKNAGLSDVVRRKGLHSRMKALSGGEMQMVSLARCFLKDAPLMLLDEATSKLDAETERDVFGLMMGMRGKTIVMVLHDLWMTEHLDRVILVDSGTVKEVGTHSELMGLRGMYWRMKTASRE

ABC Transporters in E. cuniculi

ABC transporters are widely distributed in parasitic protists . The genome of E. cuniculi contains a set of 13 potential genes encoding ATP-binding cassette (ABC) systems . Analyses support a distribution of E. cuniculi ABC systems within four subfamilies .

Some notable features of ABC systems in E. cuniculi:

  • Six half transporters are homologous to the yeast ATM1 mitochondrial protein .

  • Five half transporters are similar to the human ABCG1 and ABCG2 proteins .

  • Absence of homologs of P-glycoprotein and other ABC transporters involved in multiple drug resistance in many eukaryotic microorganisms .

Function and Role

ABC transporters in parasitic protists are linked to drug resistance, but their physiological roles are not well understood . Some ABC transporters have been localized to the plasma membrane of parasites . While ABC transporters are best characterized as exporters in eukaryotes and parasitic protists, their role in the importation and salvage of nutrients may be an important component of the parasitic lifestyle .

Potential Applications

Recombinant Encephalitozoon cuniculi Probable ABC transporter ECU01_0200/ECU01_1410 (ECU01_0200) can be utilized in various research applications:

  • Drug Discovery: Studying the role of this ABC transporter in drug resistance mechanisms .

  • Nutrient Salvage: Investigating its potential involvement in nutrient transport and metabolism within E. cuniculi .

  • Structural Biology: Analyzing the protein structure to understand its function and interaction with other molecules.

  • Antibody Development: Creating antibodies against this transporter for diagnostic or therapeutic purposes.

  • Understanding Allostery: Studying the allosteric networks within the ABC transporter to understand how ATP binding and substrate-binding proteins affect its function .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ECU01_0200; ECU01_1410; Probable ABC transporter ECU01_0200/ECU01_1410
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-596
Protein Length
full length protein
Species
Encephalitozoon cuniculi (strain GB-M1) (Microsporidian parasite)
Target Names
ECU01_0200;
Target Protein Sequence
MRRMDRWTVCRRLASMARPVSFLEAALMAVVAACIVLGKWFDVMSIKRRGLIINGLKDIK GMGSANVSSIYGDAAAFLVLRTLSSAFTESKAILFSAVTNRVVQASTSRILDLTMHAAHS CEIKPTELNRIVERGNRKISKVLVKTLTVATPALFRLALLFREVHAMFGPKYLVPILFTA AAYAAYTCVMLRIRARYRKEINNADNSVSRRIHECVSNVDLVRACCSEQFEVSRLAGEME TMWALKLSDKGCVGMTNLGQRALFSVLFVHVAFKGIADMAALRMTVGDLSVLFSFVLSID ASMWTLGGIARDLGFWLTDCTDLLCLHDGLERAAEQGPGAGAAAEGMAACPSSPPGEAAA VEFDDVSFAYPRSAAYPRSAHVLSGVSFRIMRGERVGIIGRPGSGKSTILRLILMLHRHK GRIRVNGAELWSASPRAVRGSIGCILQDGLLFDESILYNVMYGCPRAGFHRVLRECKNAG LSDVVRRKGLHSRMKALSGGEMQMVSLARCFLKDAPLMLLDEATSKLDAETERDVFGLMM GMRGKTIVMVLHDLWMTEHLDRVILVDSGTVKEVGTHSELMGLRGMYWRMKTASRE
Uniprot No.

Target Background

Database Links
Protein Families
ABC transporter superfamily, ABCB family, Heavy Metal importer (TC 3.A.1.210) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Q: What is the basic structure and classification of the ECU01_0200/ECU01_1410 transporter?

ABC transporters like ECU01_0200/ECU01_1410 belong to one of the largest protein superfamilies known in nature. Based on phylogenetic analysis, ECU01_0200 and ECU01_1410 are identical proteins from Encephalitozoon cuniculi and are part of a specific group of fungal ABC transporters . The protein consists of 596 amino acids and includes the characteristic ABC transporter domains: nucleotide-binding folds (NBFs) containing the conserved Walker A and Walker B motifs separated by approximately 120 amino acids, and an ABC signature motif situated between the two Walker boxes . The prototypical structure of ABC transporters includes four core domains - two NBFs and two transmembrane domains (TMDs) that can be expressed either as separate polypeptide chains or as a single multidomain protein .

Q: Why are ECU01_0200 and ECU01_1410 designated with different identifiers if they are identical?

The dual naming of this protein (ECU01_0200/ECU01_1410) reflects a duplication in the E. cuniculi genome. Phylogenetic analysis has confirmed that these two proteins (ECU01_0200 and ECU01_1410) are indeed identical . This duplication is noteworthy as E. cuniculi has a highly reduced genome compared to other fungi, with only six ABC transporters in total . Such gene duplications may indicate functional importance, potentially providing redundancy for essential transport functions in this organism's simplified genomic landscape.

Q: What is known about the presence of ABC transporters in Encephalitozoon cuniculi compared to other fungal species?

Fungal GroupTypical ABC Transporter CountE. cuniculi CountMissing Subfamilies in E. cuniculi
PezizomycotinaHighest diversity (>30)6ABC-A, full-size ABC-B
SaccharomycotinaModerate diversity6ABC-A
BasidiomycetesVariable6ABC-A

Q: What expression systems are most effective for producing recombinant ECU01_0200/ECU01_1410 protein for structural studies?

When designing expression experiments, researchers might adopt strategies similar to those used for other ABC transporters, such as the work done with PlnG from Lactobacillus plantarum where heterologous expression in E. coli BL21(DE3) was successful . For optimal results, consider:

  • Using low-temperature induction to improve protein folding

  • Testing multiple affinity tags beyond His-tags (e.g., MBP fusion) if solubility issues arise

  • Employing specialized E. coli strains designed for membrane protein expression

  • Exploring eukaryotic expression systems for complex functional studies

Q: What purification protocols yield the highest activity for recombinant ECU01_0200/ECU01_1410?

Based on comparable ABC transporter purification research, a multi-step purification protocol is recommended for obtaining high-activity ECU01_0200/ECU01_1410. Begin with affinity chromatography using the His-tag, followed by ion exchange chromatography and size exclusion chromatography for highest purity. The protocol for PlnG purification demonstrated that recombinant ABC transporters can retain their processing activity after purification, which is critical for functional studies .

Critical considerations include:

  • Using detergents that maintain the native conformation of the transmembrane domains

  • Including ATP or non-hydrolyzable ATP analogs during purification to stabilize the nucleotide-binding domains

  • Minimizing exposure to proteases by including inhibitors throughout the purification process

  • Conducting activity assays at each purification step to monitor functional integrity

Q: How can I design in vitro activity assays to characterize the transport function of ECU01_0200/ECU01_1410?

Designing effective in vitro activity assays for ECU01_0200/ECU01_1410 requires consideration of both ATPase activity and transport functionality. A methodological approach used successfully for other ABC transporters involves:

  • ATPase activity assay: Measure ATP hydrolysis using colorimetric detection of released phosphate. Compare basal activity with substrate-stimulated activity to identify potential transport substrates.

  • Reconstitution into liposomes: Incorporate purified protein into artificial membrane vesicles for transport studies. This method was effective in studying the activity of the PlnG ABC transporter from L. plantarum .

  • Fluorescent substrate tracking: Utilize fluorescently labeled potential substrates to monitor transport across the reconstituted membrane system.

  • Competitive inhibition assays: Use known ABC transporter inhibitors (e.g., vanadate) to confirm observed activity is specific to the ABC transporter mechanism.

Based on research with other ABC transporters, ensure the assay buffer contains appropriate levels of magnesium, as this divalent cation is essential for ATP hydrolysis by the NBDs .

Q: What are the predicted substrates for ECU01_0200/ECU01_1410 based on its phylogenetic classification?

While the specific substrates for ECU01_0200/ECU01_1410 have not been directly identified in the available research, predictions can be made based on phylogenetic relationships with other fungal ABC transporters. ABC transporters are known to transport a remarkably broad range of substrates across biological membranes . Since E. cuniculi lacks both ABC-A transporters (typically involved in lipid transport) and full-size ABC-B transporters (often associated with pheromone export and multidrug resistance), the ECU01_0200/ECU01_1410 transporter likely handles essential substrates required for parasite survival .

Potential substrate categories might include:

  • Essential nutrients or metabolic precursors needed by this obligate intracellular parasite

  • Peptides or small molecules involved in host-parasite interactions

  • Toxic compounds that need to be exported from the parasite cell

  • Essential cellular components like iron-sulfur cluster proteins, as seen with some yeast ABC transporters

Further comparative analysis with close phylogenetic relatives could refine these predictions.

Q: How can I distinguish between direct and indirect substrates of ECU01_0200/ECU01_1410?

Distinguishing between direct and indirect substrates requires a multilayered experimental approach:

  • In vitro transport assays: Using purified protein reconstituted in liposomes, test direct transport of radiolabeled or fluorescently tagged candidate substrates. Direct substrates will show ATP-dependent accumulation or efflux.

  • ATPase stimulation screening: Measure changes in ATPase activity in the presence of potential substrates. Direct substrates typically stimulate ATP hydrolysis, though exceptions exist.

  • Competition assays: Determine if suspected substrates compete with known transported molecules. True substrates will demonstrate competitive inhibition.

  • Binding studies: Use techniques like surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to measure direct binding of potential substrates to the purified transporter.

  • Mutagenesis of binding sites: Create targeted mutations in predicted substrate-binding regions and observe effects on transport activity. This approach was used successfully with other ABC transporters to confirm direct substrate interactions .

For indirect effects, complement these approaches with in vivo studies tracking metabolic changes in response to transporter inhibition or deletion.

Q: What functional domains in ECU01_0200/ECU01_1410 determine substrate specificity?

The substrate specificity of ABC transporters like ECU01_0200/ECU01_1410 is primarily determined by the transmembrane domains (TMDs), which form the translocation pathway. Based on structural studies of related ABC transporters, several key features likely influence specificity:

  • Transmembrane helices arrangement: The spatial configuration of the TMDs creates a substrate-binding pocket with specific physicochemical properties that determine which molecules can be recognized.

  • Coupling helices: These short helices connect the TMDs to the NBDs and transmit conformational changes during the transport cycle, potentially influencing substrate selection.

  • Extracellular loops: The regions between transmembrane segments often contain residues that interact with substrates before they enter the transport channel.

  • NBD-TMD interface: While nucleotide-binding domains primarily bind and hydrolyze ATP, their interaction with the TMDs can allosterically affect substrate binding.

Notably, the degree of conservation in transmembrane domains between different subfamilies of fungal ABC proteins is low compared to the more conserved NBDs, suggesting that TMDs evolved to accommodate different substrates . Detailed homology modeling based on recently solved ABC transporter structures, such as the mouse P-glycoprotein, could provide insights into the structural basis of ECU01_0200/ECU01_1410 substrate specificity .

Q: How does ECU01_0200/ECU01_1410 compare structurally and functionally to human ABC transporters?

Comparing ECU01_0200/ECU01_1410 to human ABC transporters reveals both similarities and potential parasitic adaptations. While specific structural data for ECU01_0200/ECU01_1410 is limited, the conserved domain organization of ABC transporters allows for meaningful comparison.

Similarities to human ABC transporters:

  • Presence of characteristic Walker A and B motifs in the nucleotide-binding domains

  • ABC signature sequence between Walker motifs

  • Utilization of ATP hydrolysis to power substrate transport

Key differences may include:

  • Reduced structural complexity reflecting E. cuniculi's genome minimization

  • Potential specialization for parasite-specific transport needs

  • Likely divergent substrate specificity profile

Human ABC transporters are extensively diversified into subfamilies (ABC-A through ABC-G), many involved in clinically relevant processes like multidrug resistance in cancer (P-glycoprotein) and lipid transport disorders (ABCA1) . Understanding the structural and functional differences between ECU01_0200/ECU01_1410 and human transporters could identify parasite-specific features that might be exploited for therapeutic development against microsporidiosis.

Q: What can the evolutionary conservation of ECU01_0200/ECU01_1410 tell us about its essential function?

  • Retention despite genome reduction: E. cuniculi has undergone extreme genome reduction as an obligate intracellular parasite, yet it maintains multiple ABC transporters, suggesting they perform critical functions that cannot be eliminated .

  • Gene duplication: The identical nature of ECU01_0200 and ECU01_1410 indicates a gene duplication event, which is particularly significant in a minimalist genome where redundancy is typically eliminated unless it confers a selective advantage .

  • Conservation across fungal lineages: Phylogenetic analysis of fungal ABC transporters shows conservation of certain subfamilies across diverse fungal species spanning hundreds of millions of years of evolution .

  • Subfamilies absent in E. cuniculi: The absence of ABC-A and full-size ABC-B transporters in E. cuniculi suggests that ECU01_0200/ECU01_1410 may have taken on critical functions normally handled by these missing transporters in other fungi .

This conservation pattern suggests that ECU01_0200/ECU01_1410 likely performs a transport function that is essential for parasite survival and cannot be accomplished by host transporters or other mechanisms.

Q: How do transport mechanisms differ between ECU01_0200/ECU01_1410 and other fungal ABC transporters?

The transport mechanism of ECU01_0200/ECU01_1410 likely follows the core ABC transporter cycle but may have unique adaptations compared to other fungal transporters. Based on comparative analysis:

  • Conformational changes: All ABC transporters undergo ATP-dependent conformational changes alternating between inward- and outward-facing states. The ECU01_0200/ECU01_1410 likely uses this conserved mechanism but may have modified coupling between ATP hydrolysis and substrate translocation.

  • Half vs. full transporters: Unlike some fungi that possess both half-size and full-size ABC transporters, E. cuniculi appears to rely primarily on half-transporters that must dimerize to function . This may impact the regulation of transport activity through controlled dimerization.

  • Specialized transport niches: With E. cuniculi lacking entire subfamilies of ABC transporters found in other fungi, the remaining transporters like ECU01_0200/ECU01_1410 may have broader substrate specificity to compensate for the missing transporters .

  • Energy efficiency: As an obligate intracellular parasite with limited metabolic capacity, ECU01_0200/ECU01_1410 may have evolved mechanisms to operate with greater ATP efficiency compared to transporters in free-living fungi.

Further comparative transport studies with related fungal ABC transporters could reveal the extent to which ECU01_0200/ECU01_1410 has adapted its mechanism to the parasitic lifestyle.

Q: What approaches can be used to identify potential inhibitors of ECU01_0200/ECU01_1410 for therapeutic development?

Identifying inhibitors of ECU01_0200/ECU01_1410 for potential therapeutic applications against microsporidiosis requires a multifaceted approach:

  • Structure-based virtual screening: Develop homology models of ECU01_0200/ECU01_1410 based on related ABC transporters with solved structures, then use computational docking to screen large compound libraries for potential binding to critical sites.

  • High-throughput ATPase assays: Screen compound libraries for molecules that inhibit the ATPase activity of purified ECU01_0200/ECU01_1410, adapting methodologies used for other ABC transporters .

  • Transport inhibition assays: Develop liposome-based transport assays to directly measure inhibition of substrate translocation.

  • Parasite growth inhibition: Test candidate inhibitors for their ability to inhibit E. cuniculi growth in cell culture, with follow-up studies to confirm the mechanism involves ECU01_0200/ECU01_1410 inhibition.

  • Selectivity screening: Compare inhibition of ECU01_0200/ECU01_1410 with effects on human ABC transporters to identify compounds with selectivity for the parasite protein.

  • Repurposing known inhibitors: Test known inhibitors of related ABC transporters, particularly those with established safety profiles, as potential leads.

This systematic approach could identify compounds that disrupt essential transport functions in E. cuniculi while minimizing effects on host transporters.

Q: How can CRISPR/Cas9 technology be adapted to study ECU01_0200/ECU01_1410 function in Encephalitozoon cuniculi?

Adapting CRISPR/Cas9 for ECU01_0200/ECU01_1410 functional studies in E. cuniculi presents unique challenges due to this organism's intracellular parasitic nature and minimal genome. A methodological approach might include:

  • Delivery system optimization: Develop methods to deliver Cas9 and guide RNAs to E. cuniculi, potentially using cell-penetrating peptides or transfection during the extracellular spore stage.

  • Target selection strategy:

    • Target only one copy (ECU01_0200 or ECU01_1410) to assess functional redundancy

    • Target unique flanking regions to affect both copies simultaneously

    • Create conditional knockdowns rather than complete knockouts if the function is essential

  • Verification methods:

    • PCR and sequencing to confirm genomic modifications

    • Quantitative proteomics to verify protein reduction

    • Transport assays to measure functional consequences

  • Phenotypic analysis:

    • Growth rate in host cells

    • Spore formation efficiency

    • Host cell response modifications

    • Metabolomic changes indicating transport deficiencies

  • Complementation studies: Reintroduce modified versions of the transporter to confirm phenotype specificity and investigate structure-function relationships.

Since traditional genetic manipulation of E. cuniculi has been challenging, successful adaptation of CRISPR/Cas9 would represent a significant methodological advancement for microsporidia research.

Q: What role might ECU01_0200/ECU01_1410 play in host-parasite interactions during Encephalitozoon cuniculi infection?

The potential roles of ECU01_0200/ECU01_1410 in host-parasite interactions during E. cuniculi infection present fertile ground for advanced research. Several hypotheses warrant investigation:

  • Nutrient acquisition: As an obligate intracellular parasite with reduced metabolic capacity, E. cuniculi may use ECU01_0200/ECU01_1410 to import essential nutrients from the host cell that it cannot synthesize independently.

  • Evasion of host defense mechanisms: The transporter might export compounds that interfere with host immune recognition or response pathways, similar to how some bacterial ABC transporters export factors that modulate host defenses.

  • Detoxification functions: ECU01_0200/ECU01_1410 could export host-derived toxic compounds that would otherwise accumulate within the parasite.

  • Parasite development regulation: The transporter might be involved in signaling processes that coordinate the parasite's developmental transitions within the host cell.

  • Compensation for missing transporters: Given that E. cuniculi lacks several ABC transporter subfamilies found in other fungi, ECU01_0200/ECU01_1410 may perform multiple functions that are distributed among different transporters in free-living fungi .

Research approaches to investigate these possibilities include:

  • Temporal expression analysis during different infection stages

  • Localization studies within the parasite-host interface

  • Metabolomic analysis comparing wild-type and transporter-inhibited parasites

  • Comparative transcriptomics of host cells infected with wild-type versus transporter-deficient parasites

Q: What are the major technical barriers to structural characterization of ECU01_0200/ECU01_1410?

Structural characterization of ECU01_0200/ECU01_1410 faces several technical challenges that require specialized approaches:

  • Membrane protein crystallization:

    • Inherent flexibility of ABC transporters complicates crystallization

    • Detergent selection is critical for maintaining native conformation

    • Lipidic cubic phase methods may improve crystallization success

  • Expression and purification barriers:

    • Achieving sufficient expression levels of functional protein

    • Maintaining stability during purification steps

    • Ensuring proper folding of transmembrane domains in expression systems

  • Conformational heterogeneity:

    • ABC transporters exist in multiple conformational states during transport cycle

    • Stabilizing a single conformation may require nucleotide analogs or conformation-specific antibodies

  • Cryo-EM alternatives:

    • Single-particle cryo-electron microscopy can overcome some crystallization challenges

    • May require optimization for the relatively small size of ECU01_0200/ECU01_1410

    • Sample preparation and particle orientation diversity are critical factors

  • Computational modeling limitations:

    • Homology modeling accuracy depends on template selection

    • Transmembrane domain modeling is particularly challenging

    • Validation of models requires experimental data

Future technological developments in membrane protein structural biology, particularly advances in cryo-EM resolution for smaller proteins and improved crystallization methods, may overcome these barriers.

Q: How might systems biology approaches advance our understanding of ECU01_0200/ECU01_1410 function?

Systems biology approaches offer powerful frameworks for understanding the integrated role of ECU01_0200/ECU01_1410 within E. cuniculi's biology:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data to identify metabolic networks linked to ECU01_0200/ECU01_1410 function

    • Temporal analysis during infection cycle can reveal stage-specific roles

    • Comparative analysis between wild-type and inhibited conditions can identify affected pathways

  • Network analysis:

    • Construct protein-protein interaction networks to identify partners of ECU01_0200/ECU01_1410

    • Map metabolic dependencies to predict essential transport functions

    • Model regulatory networks controlling transporter expression

  • Flux balance analysis:

    • Develop constraint-based models of E. cuniculi metabolism incorporating transporter constraints

    • Predict metabolic consequences of transporter inhibition

    • Identify potential compensatory mechanisms

  • Host-parasite interactome mapping:

    • Identify host factors that interact with pathways dependent on ECU01_0200/ECU01_1410

    • Model the exchange of metabolites between host and parasite

    • Predict systemic effects of transporter inhibition

  • Comparative systems analysis:

    • Compare system-level organization of transport functions between E. cuniculi and other fungi

    • Identify adaptations specific to the parasitic lifestyle

    • Reveal convergent solutions to transport challenges across diverse parasites

These approaches would place ECU01_0200/ECU01_1410 in its broader biological context, potentially revealing unexpected functions and interconnections within the parasite's streamlined biology.

Q: What controversies exist in the literature regarding the function and importance of ABC transporters in microsporidia like E. cuniculi?

Several controversies and unresolved questions exist regarding ABC transporters in microsporidia:

  • Functional redundancy controversy:

    • The presence of identical copies (ECU01_0200/ECU01_1410) raises questions about whether this represents functional redundancy or regulation through gene dosage

    • Some researchers suggest redundancy provides reliability for essential functions, while others propose differentiated expression patterns despite sequence identity

  • Missing subfamily debate:

    • The absence of entire ABC transporter subfamilies in E. cuniculi has led to competing hypotheses:
      a) Host transporters compensate for missing parasite transporters
      b) Remaining transporters have expanded substrate range
      c) Alternative transport mechanisms have evolved

    • The research community remains divided on which explanation predominates

  • Evolutionary origin questions:

    • Microsporidia were originally classified as ancient eukaryotes but are now recognized as fungi

    • Controversy remains about whether their ABC transporter complement represents ancient conservation or specialized reduction

    • Phylogenetic analyses show conflicting signals depending on methods used

  • Therapeutic potential disagreement:

    • Some researchers advocate targeting microsporidian ABC transporters for therapeutic development

    • Others express concern about cross-reactivity with human ABC transporters

    • The debate continues about whether sufficient selectivity can be achieved

  • Methodological challenges:

    • Technical disagreements exist about the best approaches to study these transporters

    • Some favor in vitro biochemical approaches while others argue for genetic systems despite technical difficulties

    • Standardized functional assays for microsporidian ABC transporters remain to be established

Resolving these controversies will require new experimental approaches and greater collaboration between microsporidia researchers and ABC transporter specialists.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.