Recombinant Encephalitozoon cuniculi Putative subtilisin-like proteinase 2 (SPL2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
SPL2; ECU03_1180; Putative subtilisin-like proteinase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
18-535
Protein Length
Full Length of Mature Protein
Species
Encephalitozoon cuniculi (strain GB-M1) (Microsporidian parasite)
Target Names
SPL2
Target Protein Sequence
NGGLETNEVAGMDRLGVESQKENPPGILLRKDDGMCEARKPMDMSPGEVQTETKTVVKEI VVEIEEPREGIQEVLPVVQYEGQAKVSAGNDLLKPSCGVSSGFTSSAERCYVLTKDAHDG DTSKMISLVESLSGRVKRQYTKNITGVSFCSSHSDVLRKVDDAGMHVEEDKIYTVSMLQN NIPNYMYLMRHYENTIFNNYFYDNWIFRVLQIKRVMTKFLGSYEYYHTGKGVNIFLLDTA ISSMDGACNLSGRLEACNAHGNVMAELLVGKTNGFAKDSRLSVLDVVDCDGKVALSEMIH GLEGLRESGGPSILVFGVSGPYSASLNSAVDRISSRGTVVVSPAGNSHDQSCNYSPGSSK SVINVGSVDKHAGISRFSNHGDCIRMFAPGEDVLQDSSLTGTSLSAAIVASSIALFLETS PRAAFPQIWGYLNQNSFWNSRGSYSVLKIPRLGCKGRIRGSIFRLGGLYEDIVPLVFVVL ITSALLYLLLIGIRRFRRRREQELHDEDVLFDPPVDRF
Uniprot No.

Target Background

Function
This protein may be involved in protein degradation for nutrient acquisition or exert a regulatory function through the proteolytic activation of proproteins.
Database Links
Protein Families
Peptidase S8 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Encephalitozoon cuniculi Putative subtilisin-like proteinase 2 (SPL2)?

SPL2 (gene name SPL2, locus ECU03_1180) is a putative subtilisin-like serine protease found in the microsporidian parasite Encephalitozoon cuniculi. This protein belongs to the peptidase S8 family and has presumed enzymatic activity (EC 3.4.21.-) as indicated by its classification. The protein is found in E. cuniculi, which has been extensively studied for its minimalistic genomic features and is known to cause encephalitozoonosis in multiple host species .

The protein has 535 amino acids with an expression region from positions 18-535. Its functional domains suggest it may play important roles in host-pathogen interactions, potentially through protein processing or degradation activities that facilitate parasite invasion or survival within host cells.

How is the SPL2 gene organized within the E. cuniculi genome?

The SPL2 gene is located at the ECU03_1180 locus in the E. cuniculi genome. Based on genomic studies of E. cuniculi, we know that this organism possesses one of the smallest known eukaryotic genomes (approximately 2.9 Mb), characterized by gene compaction and minimal intergenic regions . The genetic organization reflects the evolutionary pressure toward genomic reduction in these obligate intracellular parasites.

How might genetic variations in SPL2 affect its function across different E. cuniculi strains?

Genetic variations in SPL2 across different E. cuniculi strains could significantly impact protein function, substrate specificity, and pathogenicity. Current research has identified three main genotypes of E. cuniculi (I, II, and III), which show distinct genetic characteristics. While specific data on SPL2 variation is limited in the provided sources, we can extrapolate from general genomic studies of E. cuniculi strains.

Genomic analyses have revealed extremely low levels of heterozygosity in E. cuniculi compared to other microsporidians. For instance, only 23 nucleotide sites (less than 0.00001% of the total genome) show heterozygosity in E. cuniculi, versus over 42,175 sites (1.035% of the genome) in species like Nematocida . This suggests that functional proteins like SPL2 may be highly conserved across strains.

GenotypeGeneProductPolymorphism typeProtein effectNucleotide changeAmino acid changePosition in coding sequence
IECU02_0050Hypothetical proteinSNP (transversion)NoneC/A-1738
IECU02_0050Hypothetical proteinSNP (transition)SubstitutionG/AR → W1736
IECU02_0260GATA zinc finger transcription factor 3SNP (transition)TruncationC/T-60
IECU02_0720Histone H2ASNP (transition)NoneA/G-221
IECU05_1190ABC transporterSNP (transition)NoneA/G-381

Similar variations, if present in SPL2, could affect catalytic activity, substrate recognition, or protein-protein interactions, potentially altering virulence across different strains .

What role does SPL2 play in host-pathogen interactions during E. cuniculi infection?

SPL2, as a subtilisin-like protease, likely plays critical roles in host-pathogen interactions during E. cuniculi infection. Proteases in microbial pathogens typically function in multiple aspects of pathogenesis, including invasion, immune evasion, and nutrient acquisition.

In the context of E. cuniculi infection, SPL2 may facilitate:

  • Host cell invasion - by degrading extracellular matrix components or modifying host cell surface proteins

  • Immune evasion - through cleavage of host immune factors such as complement proteins or cytokines

  • Nutrient acquisition - by processing host proteins for parasite metabolism

E. cuniculi infection triggers complex host immune responses. In experimental infections, both cell-mediated and humoral immunity are activated. CD4+ and CD8+ T lymphocytes show distinctive proliferation patterns throughout infection, with CD4+ T cells predominating early (2 weeks post-infection) and CD8+ T cells becoming more prominent later (6-8 weeks post-infection) .

The cytokine response is characterized by high levels of IFN-γ mRNA in the spleen, mesenteric lymph nodes, and Peyer's patches, indicating a dominant Th1 immune response. Interestingly, in the small intestine, IL-4, IL-10, and IL-17 mRNA levels exceed IFN-γ mRNA at weeks 4 and 6 post-infection, suggesting tissue-specific immune regulation . SPL2 may interact with these immune components, potentially modulating the host response to facilitate parasite persistence.

How can researchers study the enzymatic activity of SPL2 in relation to microsporidian pathogenesis?

Studying SPL2 enzymatic activity requires a multifaceted approach combining biochemical, molecular, and cellular techniques. Researchers should consider the following methodological approaches:

  • Recombinant protein expression and purification: Express SPL2 in bacterial, yeast, or insect cell systems with appropriate tags for purification. The full amino acid sequence available from UniProt (Q8SS86) provides the foundation for designing expression constructs .

  • Enzymatic assays: Develop substrate-specific assays using fluorogenic or chromogenic peptides that mimic potential natural substrates. Since SPL2 is classified as EC 3.4.21.- (serine protease), researchers can start with known subtilisin substrates and optimize conditions (pH, temperature, cofactor requirements).

  • Inhibitor studies: Test the effect of protease inhibitors on SPL2 activity to confirm its classification and identify potential therapeutic targets. Class-specific inhibitors for serine proteases (e.g., PMSF, aprotinin) should affect activity if SPL2 functions as predicted.

  • Cell-based assays: Analyze SPL2's role in infection by generating recombinant E. cuniculi with modified SPL2 (knockdown, overexpression, or mutation of catalytic sites) and assess changes in infection efficiency, host cell invasion, or intracellular development.

  • Host substrate identification: Use techniques like TAILS (Terminal Amine Isotopic Labeling of Substrates) or degradomics approaches to identify host proteins cleaved by SPL2 during infection.

These methodologies would provide insights into how SPL2 contributes to the pathogenesis of E. cuniculi, which manifests primarily as neurological, ocular, and renal disease in affected hosts .

What are the potential applications of SPL2 research in therapeutic development?

SPL2 research has several potential applications in therapeutic development against encephalitozoonosis:

  • Drug target identification: As a protease potentially involved in host cell invasion or survival, SPL2 represents a promising target for anti-microsporidian drugs. Structure-based drug design could lead to specific inhibitors that disrupt SPL2 function without affecting host proteases.

  • Diagnostic tool development: Recombinant SPL2 can be used to develop sensitive and specific immunodiagnostic assays for detecting E. cuniculi infections. ELISA-based tests using recombinant SPL2 could provide earlier detection than current methods .

  • Vaccine development: If SPL2 is surface-exposed or secreted during infection, it could serve as an antigen in subunit vaccine formulations. Understanding SPL2's immunogenicity and role in protective immunity would be crucial for this application.

  • Cross-species protection: E. cuniculi affects multiple mammalian species, including humans, with particular significance in immunocompromised individuals . Therapeutics targeting conserved proteins like SPL2 might provide cross-species protection.

Research should consider the One Health perspective, as encephalitozoonosis can affect both animals and humans. Therapeutic approaches should be evaluated in multiple host species to ensure broad efficacy against this zoonotic pathogen .

What are the optimal methods for recombinant expression and purification of SPL2?

The optimal methods for recombinant expression and purification of SPL2 depend on the research objectives and downstream applications. Based on the protein characteristics described in the search results, researchers should consider:

  • Expression systems:

    • Bacterial expression (E. coli): Suitable for basic structural studies and initial characterization. Use codon-optimized constructs to overcome potential codon bias. Consider expressing catalytic domains separately if full-length expression is problematic.

    • Eukaryotic systems (yeast, insect cells): More appropriate for functional studies requiring proper folding and post-translational modifications. Pichia pastoris or Sf9 insect cells often provide higher yields of active proteases.

  • Expression constructs:

    • Include appropriate tags for detection and purification (His6, GST, MBP)

    • Consider removing transmembrane domains if present (analyze the amino acid sequence for hydrophobic regions)

    • Include a precision protease cleavage site for tag removal if necessary for activity studies

  • Purification strategy:

    • Initial capture: Affinity chromatography based on fusion tag

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography

    • Consider adding protease inhibitors during purification to prevent autodegradation

  • Quality control:

    • SDS-PAGE and Western blotting for purity assessment

    • Mass spectrometry for identity confirmation

    • Circular dichroism for secondary structure verification

    • Activity assays using fluorogenic substrates to confirm functional integrity

The amino acid sequence provided (from position 18-535) suggests potential signal peptides or transmembrane regions that might affect expression and solubility . Careful construct design is critical for successful expression of functional protein.

How can ELISA techniques be effectively utilized for studying SPL2?

ELISA techniques offer versatile applications for studying SPL2 in both basic research and diagnostic contexts:

  • Antigen detection ELISA:

    • Direct detection of SPL2 in clinical or experimental samples

    • Sandwich ELISA using anti-SPL2 antibodies for capture and detection

    • Optimization requires careful antibody selection and validation

  • Antibody detection ELISA:

    • Indirect ELISA using recombinant SPL2 as coating antigen to detect anti-SPL2 antibodies in host serum

    • Can be used to study serological responses across different stages of infection

    • Important for epidemiological studies of E. cuniculi exposure

  • Competitive ELISA:

    • Useful for studying binding interactions between SPL2 and potential substrates or inhibitors

    • Can measure relative binding affinities and specificity

  • ELISA optimization considerations:

    • Antigen coating concentration: Typically 1-10 μg/mL of purified recombinant SPL2

    • Blocking agents: BSA or casein to prevent non-specific binding

    • Detection systems: HRP-conjugated secondary antibodies with appropriate substrates

    • Controls: Include recombinant SPL2 positive controls and non-related protein negative controls

What molecular biology techniques are most effective for studying SPL2 gene expression?

Several molecular biology techniques can effectively study SPL2 gene expression during different stages of E. cuniculi's life cycle and infection process:

  • Quantitative RT-PCR (qRT-PCR):

    • Allows precise quantification of SPL2 mRNA levels

    • Can compare expression across different developmental stages or under different conditions

    • Requires careful selection of reference genes for normalization (challenging in microsporidians due to their reduced genomes)

    • Design primers based on the known sequence at locus ECU03_1180

  • RNA-Seq:

    • Provides comprehensive transcriptomic profile including SPL2

    • Allows identification of co-expressed genes that may function in the same pathways

    • Can reveal alternative splicing or transcription start sites

    • Particularly valuable for understanding expression in the context of the entire transcriptome

  • In situ hybridization:

    • Localizes SPL2 mRNA within parasite cells or infected tissues

    • Provides spatial information about expression patterns

    • Can be combined with immunohistochemistry for protein localization

  • Reporter gene assays:

    • Construct fusions of SPL2 promoter regions with reporter genes

    • Test activity in heterologous systems or, if possible, in transgenic E. cuniculi

    • Identify regulatory elements controlling expression

  • Chromatin immunoprecipitation (ChIP):

    • Identify transcription factors binding to SPL2 promoter

    • Map epigenetic modifications that may regulate expression

E. cuniculi's genome is characterized by extreme reduction and compaction, with minimal intergenic regions . This compact genomic organization may affect gene expression regulation and should be considered when designing experiments.

How can structural biology approaches enhance our understanding of SPL2 function?

Structural biology approaches can significantly enhance our understanding of SPL2 function by revealing its three-dimensional architecture, active site configuration, substrate binding mechanisms, and potential inhibitor binding sites:

  • X-ray crystallography:

    • Provides high-resolution structural data

    • Requires milligram quantities of highly purified, homogeneous protein

    • Can be used to determine structures of SPL2 alone, with substrates, or with inhibitors

    • Crystal trials should explore various conditions, with and without potential cofactors or substrate analogs

  • Cryo-electron microscopy (cryo-EM):

    • Alternative when crystallization is challenging

    • Can capture different conformational states

    • Particularly useful if SPL2 forms complexes with other proteins

  • Nuclear Magnetic Resonance (NMR) spectroscopy:

    • Suitable for studying smaller domains of SPL2

    • Provides information about protein dynamics in solution

    • Can identify binding sites and conformational changes upon substrate binding

  • Computational structural biology:

    • Homology modeling using related subtilisin-like proteases as templates

    • Molecular dynamics simulations to study conformational flexibility

    • Virtual screening to identify potential inhibitors

    • AlphaFold2 or similar AI-based structure prediction tools can provide initial structural models

  • Structure-function studies:

    • Site-directed mutagenesis of predicted catalytic residues

    • Activity assays with mutant proteins to correlate structure with function

    • Thermal shift assays to assess structural stability under various conditions

The amino acid sequence provided for SPL2 contains motifs characteristic of subtilisin-like proteases , which can guide initial structural predictions and experimental design. Understanding SPL2's structure would provide insights into its potential roles in E. cuniculi pathogenesis and identify opportunities for therapeutic intervention.

What controls are essential when working with recombinant SPL2 in experimental settings?

When working with recombinant SPL2, implementing rigorous controls is essential to ensure experimental validity and reproducibility:

  • Protein quality controls:

    • Purity assessment: SDS-PAGE, size exclusion chromatography

    • Identity confirmation: Western blot, mass spectrometry

    • Folding verification: Circular dichroism, thermal shift assays

    • Batch-to-batch consistency: Activity assays with standard substrates

  • Negative controls for enzymatic assays:

    • Heat-inactivated SPL2 (boiled to denature protein structure)

    • Catalytically inactive mutant (site-directed mutagenesis of predicted catalytic residues)

    • Buffer-only controls to account for spontaneous substrate hydrolysis

    • Irrelevant protein of similar size/structure to control for non-specific effects

  • Positive controls:

    • Commercial subtilisin or related proteases with known activity

    • Previously characterized batches of SPL2 with established activity profiles

    • Known inhibitors of subtilisin-like proteases (e.g., chymostatin, PMSF)

  • Specificity controls:

    • Substrate panels to determine cleavage preferences

    • Competition assays with non-cleavable substrate analogs

    • pH and temperature profiles to determine optimal conditions

  • Cell-based assay controls:

    • Mock-transfected/infected controls

    • Specific protease inhibitor treatments

    • Comparison with other E. cuniculi proteins

These controls are particularly important given the complexity of working with a protease from an obligate intracellular parasite. The amino acid sequence information provided for recombinant SPL2 should inform the design of appropriate control constructs .

How should researchers account for strain variations when studying SPL2?

To account for strain variations when studying SPL2, researchers should implement a comprehensive strategy that addresses genetic diversity across E. cuniculi genotypes:

  • Comparative sequence analysis:

    • Obtain SPL2 sequences from different E. cuniculi genotypes (I, II, and III)

    • Analyze conservation at the nucleotide and amino acid levels

    • Identify polymorphic regions, especially those affecting catalytic or substrate-binding sites

    • Consider expanding analysis to include environmental or clinical isolates beyond reference strains

  • Functional comparison:

    • Express and purify SPL2 variants from different strains

    • Compare enzymatic properties (substrate specificity, kinetics, inhibitor sensitivity)

    • Assess differences in antigenic properties relevant for diagnostic applications

  • Structural biology approaches:

    • Determine if strain-specific variations occur in structurally significant regions

    • Model the impact of amino acid substitutions on protein folding and activity

    • Focus on variations in surface-exposed regions that might affect host interactions

  • Experimental design considerations:

    • Always clearly specify which strain/genotype is being used in each experiment

    • Include multiple strains in key experiments to determine if findings are broadly applicable

    • Consider the geographical origin of strains, as this may correlate with genetic variation

What are the key considerations for in vitro versus in vivo studies of SPL2 function?

When investigating SPL2 function, researchers must carefully consider the strengths and limitations of both in vitro and in vivo approaches:

In vitro studies:

  • Advantages:

    • Controlled conditions for isolating specific parameters

    • Direct measurement of enzymatic activity

    • Ability to test multiple conditions or substrates efficiently

    • Reduced ethical concerns compared to animal models

  • Limitations:

    • May not reflect physiological conditions within host cells

    • Lack cellular context and potential cofactors

    • Cannot capture complex host-pathogen interactions

  • Key considerations:

    • Use physiologically relevant buffers and conditions (pH, temperature, salt concentration)

    • Include potential cofactors or binding partners

    • Validate findings with multiple complementary assays

    • Consider microenvironment conditions that E. cuniculi encounters in different host tissues

In vivo studies:

  • Advantages:

    • Provide physiological context

    • Capture complex host-pathogen interactions

    • Allow assessment of immune responses and tissue pathology

    • More directly relevant to disease pathogenesis

  • Limitations:

    • Complex systems with many variables

    • Difficult to isolate SPL2-specific effects

    • Ethical considerations and regulatory requirements

    • Technical challenges in sample collection and analysis

  • Key considerations:

    • Select appropriate animal models (rabbits are natural hosts, but mice are often used experimentally)

    • Consider immune status, as E. cuniculi causes more severe disease in immunocompromised hosts

    • Use tissue-specific approaches, as E. cuniculi affects multiple organs (brain, kidney, eyes)

    • Implement proper controls including mock infections and infections with E. cuniculi strains having modified SPL2

Bridging approaches:

  • Ex vivo tissue cultures to combine physiological relevance with experimental control

  • Cell culture models using relevant target cells (e.g., kidney epithelial cells, neurons)

  • Organoid systems that mimic complex tissue architecture

How can researchers effectively model SPL2 interactions with host proteins?

Modeling SPL2 interactions with host proteins requires a multifaceted approach combining computational and experimental methods:

  • Computational prediction methods:

    • Protein-protein docking simulations using SPL2 structure (experimental or predicted) and candidate host proteins

    • Molecular dynamics simulations to assess stability of predicted complexes

    • Sequence-based interaction prediction using established algorithms (e.g., PIPE, SPRINT)

    • Analysis of surface electrostatics and hydrophobicity to identify potential binding interfaces

  • Experimental validation approaches:

    • Yeast two-hybrid screening to identify host binding partners

    • Pull-down assays using tagged recombinant SPL2 as bait

    • Surface plasmon resonance (SPR) or bio-layer interferometry (BLI) to measure binding kinetics

    • Crosslinking mass spectrometry to capture transient interactions

    • FRET or BRET assays to study interactions in living cells

  • Substrate identification:

    • TAILS (Terminal Amine Isotopic Labeling of Substrates) or other degradomics approaches

    • Peptide libraries to determine cleavage site preferences

    • Proteomics comparison of infected versus uninfected cells

    • Targeted analysis of candidate substrates based on known subtilisin targets

  • Integration with infection models:

    • Validate predicted interactions in cell culture models of infection

    • Compare wild-type E. cuniculi with SPL2 mutants for changes in host protein processing

    • Use proximity labeling approaches (BioID, APEX) in infected cells to identify proteins near SPL2 during infection

  • Consideration of spatiotemporal dynamics:

    • Determine when and where SPL2 is expressed during the infection cycle

    • Identify which host compartments SPL2 accesses during infection

    • Consider the local microenvironment (pH, ionic strength, presence of inhibitors) in modeling interactions

E. cuniculi infection triggers complex immune responses involving CD4+ and CD8+ T lymphocytes, cytokines including IFN-γ, IL-4, IL-10, and IL-17, and other immune components . Understanding how SPL2 might interact with these immune factors could provide insights into immune evasion strategies employed by this pathogen.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.