Recombinant Encephalitozoon cuniculi Uncharacterized membrane protein ECU02_1470 (ECU02_1470)

Shipped with Ice Packs
In Stock

Description

Basic Properties and Production

ECU02_1470 is a 156-amino-acid membrane protein (UniProt ID: Q8SW90) expressed in E. coli with an N-terminal His-tag for purification . Key specifications include:

PropertyDetail
Protein LengthFull-length (1-156aa)
Host OrganismEncephalitozoon cuniculi (strain GB-M1)
Expression HostE. coli
Tag TypeHis-tag
Purity>90% (SDS-PAGE verified)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL); glycerol recommended for stability

The recombinant protein is lyophilized and stored at -20°C/-80°C, with repeated freeze-thaw cycles discouraged . Its expression in E. coli aligns with common strategies for producing bacterial recombinant proteins, though challenges like inclusion body formation and metabolic burden are potential limitations .

Pathogenic Context and Functional Implications

ECU02_1470 is part of E. cuniculi, a microsporidian parasite that infects mammals (e.g., rabbits, humans) via spore extrusion and intracellular replication within a non-fusigenic parasitophorous vacuole (PV) . Key associations include:

  • Zoonotic Potential: E. cuniculi genotype II strains are linked to extraintestinal microsporidiosis in immunocompromised humans, particularly those in contact with infected birds or rabbits .

  • Membrane Localization: The PV membrane of E. cuniculi resists fusion with host endosomes/lysosomes, suggesting specialized membrane proteins like ECU02_1470 may stabilize or modulate this compartment .

  • Disease Correlates: In rabbits, E. cuniculi infection is associated with anemia and neurological symptoms, though ECU02_1470’s direct role remains unexplored .

Research Applications and Diagnostic Potential

ECU02_1470 serves as a research tool and diagnostic antigen:

  • ELISA Kits: Recombinant ECU02_1470 is used in ELISA assays to detect anti-E. cuniculi antibodies, aiding in serological diagnostics .

  • Structural Studies: The AlphaFold model provides a framework for hypothesizing interactions (e.g., host membrane proteins) but requires experimental validation .

  • Functional Studies: Limited data exist on ECU02_1470’s biochemical functions, though its membrane localization implies roles in PV formation or host cell invasion .

Challenges and Future Directions

  • Expression Optimization: E. coli systems may require strain engineering or co-expression with chaperones to enhance solubility .

  • Functional Characterization: Knockout studies or cross-linking mass spectrometry could elucidate interactions with host or parasitic proteins.

  • Diagnostic Utility: Further validation is needed to assess ECU02_1470’s specificity and sensitivity in detecting E. cuniculi infections .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ECU02_1470; Uncharacterized membrane protein ECU02_1470
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Encephalitozoon cuniculi (strain GB-M1) (Microsporidian parasite)
Target Names
ECU02_1470
Target Protein Sequence
MQGGIQEEKTFQRNIKEALGDKDVTRDFFNIGRICVPQNLNDAKRRVFANLDRFKFHYLA MTAIFTLIYVLYRLELIILIGIVAAGVYAYRVRPTVCNIELEPRSVCIAGFVGILIFFIF FKEAIVGLLAISALCGIVTLTHAALLGEGLQKDDEV
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Encephalitozoon cuniculi Uncharacterized membrane protein ECU02_1470?

Recombinant Encephalitozoon cuniculi Uncharacterized membrane protein ECU02_1470 (Q8SW90) is a full-length protein (156 amino acids) derived from the microsporidian parasite Encephalitozoon cuniculi. For research applications, this protein is typically expressed in E. coli with an N-terminal His-tag to facilitate purification and detection . As a membrane protein, ECU02_1470 is integrated into the cellular membrane architecture of E. cuniculi, though its precise biological function remains to be fully characterized. The protein's membrane localization suggests potential roles in cellular transport, signaling, or host-pathogen interactions that are particularly relevant to researchers studying microsporidian biology.

What are the optimal storage and handling conditions for ECU02_1470 in laboratory settings?

For optimal research outcomes, ECU02_1470 requires specific storage and handling protocols to maintain structural integrity and functional activity:

  • Upon receipt, the lyophilized protein should be briefly centrifuged to ensure all material is at the bottom of the vial before opening.

  • Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Long-term storage requires the addition of 5-50% glycerol (final concentration, with 50% being standard) followed by aliquoting to minimize freeze-thaw cycles.

  • Store aliquots at -20°C/-80°C for long-term preservation, while working aliquots can be maintained at 4°C for up to one week.

  • Repeated freeze-thaw cycles should be strictly avoided as they significantly compromise protein stability and experimental reproducibility .

These conditions are critical for maintaining experimental consistency and ensuring that research findings accurately reflect the protein's native characteristics rather than degradation artifacts.

What expression systems are most effective for producing ECU02_1470 for research?

E. coli expression systems have been demonstrated to successfully produce recombinant ECU02_1470 with greater than 90% purity as determined by SDS-PAGE analysis . The protein is typically expressed with an N-terminal His-tag to facilitate purification through affinity chromatography. While E. coli remains the predominant expression system due to its cost-effectiveness and high yield, researchers investigating functional aspects may consider:

  • Yeast expression systems (e.g., Pichia pastoris) for potential improvements in protein folding of this eukaryotic membrane protein.

  • Insect cell systems which may provide more appropriate post-translational modifications.

  • Cell-free expression systems for membrane proteins that might be toxic to host cells.

Selection of an appropriate expression system should be guided by the specific experimental objectives, particularly whether structural or functional studies are prioritized.

What buffer systems are recommended for ECU02_1470 experiments?

For optimal stability and function in experimental settings, ECU02_1470 is typically maintained in Tris/PBS-based buffer systems with 6% trehalose at pH 8.0 . This buffer composition provides several advantages:

  • The Tris/PBS components maintain physiological ionic strength and pH buffering.

  • The inclusion of 6% trehalose serves as a protein stabilizer, particularly important for membrane proteins which often exhibit reduced stability in aqueous environments.

  • The slightly alkaline pH of 8.0 has been empirically determined to optimize protein stability.

For specific experimental applications (e.g., binding assays, activity measurements), buffer modification may be necessary but should be validated to ensure protein stability is maintained.

What experimental approaches are recommended for elucidating the function of this uncharacterized membrane protein?

To systematically investigate the function of ECU02_1470, researchers should consider a multi-faceted experimental approach:

  • Bioinformatic analysis: Begin with in-depth sequence analysis and structural prediction to identify conserved domains, transmembrane regions, and potential functional motifs. Compare with characterized proteins across species to generate functional hypotheses.

  • Protein interaction studies: Implement yeast two-hybrid, co-immunoprecipitation, or pull-down assays to identify binding partners within the E. cuniculi proteome or host proteins during infection . This can provide critical contextual information about the protein's functional network.

  • Subcellular localization: Use fluorescently tagged versions of ECU02_1470 in combination with organelle markers to precisely determine its distribution within the parasite.

  • Gene knockout/knockdown: Utilize CRISPR-Cas9 or RNAi approaches (where applicable) to assess the phenotypic consequences of ECU02_1470 deletion or reduced expression.

  • Functional complementation: Express ECU02_1470 in heterologous systems lacking functionally similar proteins to observe whether it can rescue specific phenotypes.

These approaches should be implemented within a structured experimental design framework to efficiently test hypotheses about the protein's function.

How should researchers design experiments to study ECU02_1470 interactions with other proteins?

Investigating protein-protein interactions involving ECU02_1470 requires careful experimental design that accounts for its membrane-associated nature:

  • Detergent selection is critical: Membrane proteins require appropriate detergents for solubilization while maintaining native conformations. Screen multiple detergents (e.g., DDM, CHAPS, digitonin) at various concentrations to optimize extraction conditions.

  • Use multiple complementary methods:

    • Pull-down assays using His-tagged ECU02_1470 as bait

    • Co-immunoprecipitation with specific antibodies

    • Crosslinking approaches to capture transient interactions

    • Surface plasmon resonance for quantitative binding analysis

    • Proximity labeling methods (BioID, APEX) for in vivo interaction detection

  • Controls are essential: Include appropriate negative controls (unrelated membrane proteins of similar size/topology) and positive controls (known interacting proteins if available).

  • Consider membrane microenvironments: Reconstituion in liposomes or nanodiscs may better preserve native conformation and interaction capability.

  • Validate interactions through functional assays: Confirm biological relevance by demonstrating functional consequences of disrupting identified interactions.

This systematic approach increases the likelihood of identifying genuine interaction partners while minimizing false positives that often confound membrane protein interaction studies.

What statistical approaches are recommended for analyzing ECU02_1470 experimental data?

Statistical analysis of ECU02_1470 experimental data should follow established principles of experimental design while accounting for the specific challenges of membrane protein research:

  • Experimental design considerations:

    • Implement randomization to minimize systematic errors

    • Include appropriate blocking factors when testing multiple conditions

    • Use α-resolvable designs when appropriate for complex experiments

    • Determine sample size through power analysis to ensure adequate statistical power

  • Data analysis approaches:

    • Begin with exploratory data analysis to identify potential outliers and assess data distributions

    • Apply appropriate transformations if necessary to meet statistical assumptions

    • Utilize mixed models when dealing with nested experimental factors

    • Consider non-parametric approaches for data that violate normality assumptions

    • Implement multiple comparison corrections (e.g., Bonferroni, FDR) when conducting numerous hypothesis tests

  • Experimental validation:

    • Confirm key findings through independent experimental approaches

    • Implement blinding protocols when subjective assessments are involved

    • Consider developing a data analysis plan before initiating experiments to prevent p-hacking

These statistical approaches ensure robust, reproducible findings when working with this challenging membrane protein.

What are the key considerations for developing an ECU02_1470 functional assay?

Developing functional assays for an uncharacterized membrane protein like ECU02_1470 presents significant challenges that require systematic experimental approaches:

  • Hypothesis generation:

    • Analyze sequence features for functional motifs (transport sequences, binding domains, etc.)

    • Examine structural predictions for clues to potential functions

    • Consider the cellular context of E. cuniculi and likely functional requirements

  • Assay development strategy:

    • Begin with broad phenotypic screens when function is entirely unknown

    • Test for common membrane protein functions (transport, signaling, adhesion)

    • Consider reconstitution in artificial membrane systems (liposomes, planar bilayers) to control experimental variables

    • Develop fluorescence-based or other high-throughput compatible readouts when possible

  • Validation requirements:

    • Establish appropriate positive and negative controls

    • Confirm that the recombinant form exhibits native-like behavior

    • Demonstrate dose-dependency and specificity

    • Use site-directed mutagenesis of predicted functional residues to confirm mechanism

  • Implementation considerations:

    • Optimize buffer conditions (pH, ionic strength, specific ions) that may influence function

    • Control for potential artifacts from the His-tag and consider tag removal

    • Account for membrane composition effects on protein activity

    • Establish reproducibility across different protein preparations

Thorough documentation of assay development, validation steps, and experimental conditions is essential for establishing credible functional characterization of this uncharacterized protein.

How should researchers approach the purification of ECU02_1470 for structural studies?

Purifying membrane proteins like ECU02_1470 for structural studies requires specialized approaches that differ significantly from those used for soluble proteins:

  • Expression optimization:

    • Consider testing multiple expression systems beyond E. coli, including yeast, insect cells, or mammalian systems

    • Optimize induction conditions (temperature, inducer concentration, duration) to maximize properly folded protein

    • Evaluate fusion partners that may enhance membrane protein folding and stability

  • Solubilization strategy:

    • Screen multiple detergents systematically (including newer amphipols and nanodiscs)

    • Optimize detergent concentration to ensure complete solubilization while minimizing excess

    • Consider detergent exchange during purification to transition to detergents more suitable for structural studies

  • Purification protocol:

    • Implement multi-step purification combining:

      • Initial capture via His-tag affinity chromatography

      • Secondary purification through ion exchange or size exclusion chromatography

      • Final polishing step to achieve structural biology-grade purity

    • Monitor protein quality at each step through both purity (SDS-PAGE) and homogeneity (analytical SEC, DLS) assessments

  • Sample validation:

    • Confirm protein identity through mass spectrometry

    • Assess secondary structure integrity via circular dichroism

    • Verify monodispersity through analytical ultracentrifugation or multi-angle light scattering

    • Conduct thermal stability assays to identify stabilizing conditions

  • Optimization for specific structural techniques:

    • For crystallography: screen stabilizing additives and implement surface engineering to promote crystal contacts

    • For cryo-EM: optimize grid preparation conditions and evaluate various detergents/nanodiscs

    • For NMR: consider selective labeling strategies to simplify spectral complexity

These systematic approaches maximize the likelihood of obtaining purified ECU02_1470 suitable for high-resolution structural characterization.

What experimental designs are most appropriate for studying ECU02_1470 in host-pathogen interaction models?

Investigating the role of ECU02_1470 in host-pathogen interactions requires carefully designed experiments that combine molecular and cellular approaches:

  • Cellular model selection:

    • Identify physiologically relevant host cell types based on E. cuniculi tropism

    • Consider primary cells vs. cell lines, weighing physiological relevance against experimental tractability

    • Establish appropriate infection models (timing, MOI) that allow detection of ECU02_1470-specific effects

  • Experimental approaches:

    • Implement gene silencing (RNAi) or deletion (CRISPR) of ECU02_1470 to assess impact on infection

    • Develop antibodies or tagged variants to track localization during infection

    • Use heterologous expression in host cells to identify potential dominant-negative effects

    • Consider blocking antibodies or peptide inhibitors to disrupt specific functions

  • Recommended experimental designs:

    • Factorial designs to evaluate interactions between ECU02_1470 variants and host cell types

    • Time-course studies to determine temporal dynamics of ECU02_1470 during infection

    • Blocked experimental designs when comparing multiple E. cuniculi strains or isolates

    • Split-plot designs when applying both organismal and molecular treatments

  • Phenotypic assessments:

    • Quantify parasite attachment, invasion, replication, and egress

    • Measure host cell responses (cytokine production, signaling pathway activation)

    • Assess ultrastructural features through electron microscopy

    • Use transcriptomics/proteomics to capture broader impact on host-pathogen interface

These approaches provide a framework for systematically investigating ECU02_1470's role in the complex host-pathogen relationship of E. cuniculi infections.

What are the challenges in interpreting contradictory data from ECU02_1470 functional studies?

Contradictory findings in ECU02_1470 research may arise from multiple sources requiring systematic resolution approaches:

  • Common sources of contradictions:

    • Differences in protein preparation (expression system, purification protocol, tag position)

    • Variations in experimental conditions (buffer composition, pH, temperature)

    • Differential effects in various model systems or cell types

    • Technical limitations of specific assays

    • Biological complexity of membrane protein function in different contexts

  • Resolution strategies:

    • Perform side-by-side comparisons using standardized protocols

    • Systematically test variables that differ between contradictory studies

    • Implement multiple complementary methods to address the same question

    • Consider whether contradictions represent context-dependent functions rather than true contradictions

    • Develop consensus models that integrate seemingly contradictory findings

  • Data analysis approaches:

    • Meta-analysis of multiple studies when sufficient data exists

    • Bayesian approaches to integrate prior knowledge with new findings

    • Sensitivity analysis to identify parameters that most strongly influence outcomes

    • Consider developing a biological circuit model that can reconcile apparently contradictory observations

  • Reporting recommendations:

    • Thoroughly document experimental conditions and protein characterization

    • Explicitly address contradictions with previous literature

    • Present alternative interpretations that could reconcile contradictory findings

    • Share raw data to facilitate reanalysis by other researchers

These systematic approaches can transform apparent contradictions into deeper insights about context-dependent functions of ECU02_1470.

How might ECU02_1470 research contribute to understanding microsporidian pathogenesis?

Research on ECU02_1470 has significant potential to advance our understanding of microsporidian pathogenesis through several pathways:

  • Membrane proteins often serve critical functions in host-pathogen interactions:

    • If ECU02_1470 is exposed on the parasite surface, it may participate in host cell recognition or adhesion

    • As a membrane protein, it could form channels or transporters essential for nutrient acquisition from host cells

    • It may participate in mechanisms that help the parasite evade host immune responses

    • The protein could be involved in specialized structures like the polar tube that facilitate host cell invasion

  • Comparative studies across microsporidian species:

    • Identifying ECU02_1470 homologs in other microsporidian species can reveal conserved pathogenic mechanisms

    • Species-specific variations might explain differences in host range or tissue tropism

    • Evolutionary analysis can highlight regions under selective pressure, suggesting host-interaction interfaces

  • Potential as therapeutic target:

    • Membrane proteins are often accessible to drugs and antibodies

    • If ECU02_1470 proves essential for parasite survival or virulence, it may represent a viable therapeutic target

    • Structure-based drug design could be applied once function and structure are determined

  • Model for understanding reduced pathogen genomes:

    • E. cuniculi has undergone extreme genome reduction during evolution as an obligate intracellular parasite

    • Proteins retained in this minimal genome, like ECU02_1470, likely serve essential functions

    • Understanding these core functions may reveal fundamental principles of parasitism

These research directions highlight the broader significance of ECU02_1470 beyond its immediate characterization.

What methodological advances would most benefit ECU02_1470 research?

Several methodological advances would substantially accelerate ECU02_1470 research:

  • Improved genetic manipulation tools for microsporidia:

    • Development of reliable transformation systems for E. cuniculi

    • Adaptation of CRISPR-Cas9 technology for microsporidian gene editing

    • Creation of conditional expression systems to study essential genes

    • Development of reporter systems compatible with the microsporidian cellular environment

  • Advanced structural biology approaches:

    • Application of cryo-electron microscopy for membrane protein structure determination without crystallization

    • Development of specialized nanodiscs or other membrane mimetics optimized for microsporidian membrane proteins

    • Implementation of hydrogen-deuterium exchange mass spectrometry to map functional regions

    • Computational methods for accurate structure prediction of divergent membrane proteins

  • Single-cell and in situ technologies:

    • Adaptation of single-cell transcriptomics for infected host cells

    • Development of proximity labeling methods that function within the unique microsporidian cell

    • Advanced microscopy techniques to visualize protein dynamics during host cell invasion

    • In situ structural techniques to study proteins in their native environment

  • Artificial intelligence applications:

    • Machine learning approaches for function prediction from sequence

    • Automated image analysis for high-throughput phenotypic screening

    • AI-driven experimental design to efficiently explore complex parameter spaces

    • Integration of diverse data types to generate testable hypotheses about protein function

These methodological advances would collectively transform our ability to study challenging proteins like ECU02_1470 in their biological context.

What are the recommended approaches for comparing ECU02_1470 with homologs in other species?

Comparative analysis of ECU02_1470 with potential homologs provides valuable evolutionary and functional insights through systematic approaches:

This systematic comparative approach can reveal evolutionary trajectories and functional constraints that inform experimental design and interpretation.

What are the key knowledge gaps in ECU02_1470 research that merit priority investigation?

Despite the available structural and sequence information about ECU02_1470, several critical knowledge gaps remain that represent high-priority research targets:

  • Functional characterization: The biological function of ECU02_1470 remains entirely unknown, representing the most significant knowledge gap. Determining whether it functions in transport, signaling, structural support, or host interaction would fundamentally advance our understanding.

  • Structural determination: While sequence data is available, the three-dimensional structure of ECU02_1470 has not been determined. Structural information would provide critical insights into function and mechanism.

  • Protein interactions: The interaction partners of ECU02_1470, both within E. cuniculi and potentially with host cell proteins, remain unidentified. Mapping this interaction network would provide functional context.

  • Expression and regulation: When and where ECU02_1470 is expressed during the E. cuniculi life cycle and infection process remains unknown, as does the regulation of its expression.

  • Essential nature: Whether ECU02_1470 is essential for parasite survival or virulence has not been determined, information that would indicate its potential as a therapeutic target.

Addressing these knowledge gaps through systematic research approaches would significantly advance our understanding of this uncharacterized protein and potentially reveal new insights into microsporidian biology.

How should researchers integrate multiple data types when studying ECU02_1470?

Effective integration of diverse data types is essential for comprehensive characterization of ECU02_1470:

  • Data integration framework:

    • Implement a systematic workflow that begins with sequence analysis and progressively incorporates structural predictions, experimental data, and functional assessments

    • Develop unified data models that can accommodate different data types while maintaining their relationships

    • Consider Bayesian approaches that can incorporate prior knowledge with new experimental findings

    • Implement version control for data and analyses to maintain reproducibility as the knowledge base grows

  • Cross-validation strategy:

    • Verify findings through independent methodological approaches

    • Compare results across different experimental systems

    • Use computational predictions to guide experimental design and vice versa

    • Implement iterative cycles of prediction and validation

  • Visualization approaches:

    • Develop integrated visualizations that simultaneously represent sequence, structure, and functional data

    • Create interactive models that allow exploration of complex datasets

    • Implement standardized visualization approaches to facilitate comparison across studies

    • Consider dimension reduction techniques for complex multivariate datasets

  • Data sharing considerations:

    • Adopt consistent data formats and metadata standards

    • Deposit raw data in appropriate repositories

    • Document analysis workflows to enable reproduction by other researchers

    • Consider establishing a community resource for ECU02_1470 as research progresses

This integrated approach transforms isolated findings into a coherent understanding of ECU02_1470 biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.