Recombinant Encephalitozoon cuniculi Uncharacterized membrane protein ECU04_1630 (ECU04_1630)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted per customer requirements.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is finalized during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
ECU04_1630; Uncharacterized membrane protein ECU04_1630
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-427
Protein Length
full length protein
Species
Encephalitozoon cuniculi (strain GB-M1) (Microsporidian parasite)
Target Names
ECU04_1630
Target Protein Sequence
MDAVAGPSVFVKYRRFRSLFVMQMRLWKKEPIKFYYKYSFARRGKMRAETSSGSKRTFKT LRTGFLGLVGVIAVYYALLFIFGIKYLNPQYYGSYFYAWRVNFADKLMTHGRYKLIKKNE HPETEDRKRFYRISQDKEGPYLIRFDRPEHFPRGHEHQFSLNFPAYEDFLKVRERFIVES EGLQENMKLEHSDLMEQMKKEKGGLFFASYSGKSVEEMMRILFPNNNADRNPWFDVSNIL IRAVSRIMSQDEKDREGYLFDGSEVGDDLMKDIREGLDALDRSAGDGDVLLSEKISDADI KNFFINNGRVSGTPQETFAYSRLYYLFNFLTAGIEFKSERLAELRGDGESSNEFREARMD YVANVFARIFASIYPNQHKKDVSNIGVLEKVRNYYSPKMTVDPEKEVDDADLELVRESFS RSSRISA
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is ECU04_1630 and what organism does it originate from?

ECU04_1630 is an uncharacterized membrane protein from Encephalitozoon cuniculi, an obligate intracellular microsporidian parasite. The protein consists of 427 amino acid residues and is encoded by the ECU04_1630 gene in the Encephalitozoon cuniculi GB-M1 strain. Microsporidia like E. cuniculi are traditionally associated with immunosuppressed patients, but have increasingly been detected in immunocompetent individuals, suggesting their emergence as significant pathogens . The full-length protein has been made available as a recombinant protein with histidine tag for research purposes .

What expression systems are most effective for recombinant ECU04_1630 production?

E. coli has been successfully used for recombinant expression of full-length ECU04_1630 with His-tag labeling . When choosing an expression system, consider these methodological aspects:

  • For membrane proteins like ECU04_1630, E. coli systems may face challenges with proper folding

  • Analysis of protein hydrophobicity and rare codons should be performed prior to expression

  • Optimization of expression conditions including temperature, induction time, and media composition is crucial

  • For difficult-to-express membrane proteins, eukaryotic expression systems may provide better folding environments

  • Fusion tags on both termini can help distinguish between full-length proteins and truncated products during purification

What basic structural characteristics of ECU04_1630 are currently known?

Current structural information about ECU04_1630 remains limited, as suggested by its "uncharacterized" designation. Researchers should consider:

  • The protein consists of 427 amino acids with a predicted molecular weight of approximately 49.997 kDa

  • As a membrane protein, it likely contains hydrophobic regions that span the membrane

  • Sequence analysis can predict secondary structure elements and potential transmembrane domains

  • Protein family classification algorithms may identify conserved domains or motifs shared with characterized proteins

  • Structural homology modeling based on related proteins could provide insights into possible tertiary structure

What experimental challenges arise when working with recombinant ECU04_1630?

Working with recombinant ECU04_1630 presents several experimental challenges typical of membrane proteins:

Expression challenges:

  • High hydrophobicity may cause poor solubility and expression levels

  • Rare codons can lead to translation inefficiency

  • Potential toxicity to host cells could limit yield

  • Proper folding may require specific chaperones or membrane environments

Purification challenges:

  • Membrane proteins often require detergents for solubilization

  • His-tag purification may require optimization of imidazole concentration to separate full-length protein from truncated forms

  • Multiple purification steps may be necessary to achieve high purity

  • Protein stability during purification and storage needs careful optimization

To address these challenges, researchers should consider methodological approaches including codon optimization, fusion partners to enhance solubility, and screening different detergents for optimal extraction and purification.

How can immunological methods be leveraged to detect ECU04_1630 in biological samples?

Based on immunological approaches used for related Encephalitozoon species, researchers could employ these methods for ECU04_1630 detection:

  • Monoclonal antibody development: Generate specific monoclonal antibodies against ECU04_1630 through hybridoma technology, similar to approaches used for other Encephalitozoon proteins

  • Immunofluorescence assay (IFAT): Develop protocols for detecting ECU04_1630 in fixed samples, distinguishing between antibodies recognizing:

    • Wall epitopes (exospore and endospore)

    • Internal epitopes (cytoplasmic contents or sporoplasm)

  • ELISA development: Establish quantitative detection methods using recombinant ECU04_1630 as a standard

  • Western blot protocols: Optimize for membrane protein detection with appropriate detergents and transfer conditions

  • Immunoelectron microscopy: Use immunogold labeling to precisely localize ECU04_1630 within parasite structures

For clinical or environmental samples, consider formalin fixation protocols similar to those used for detecting other microsporidian species in stool samples .

What approaches can be used to characterize protein-protein interactions of ECU04_1630?

To investigate protein-protein interactions for this uncharacterized membrane protein, consider these methodological approaches:

In vitro methods:

  • Pull-down assays using recombinant His-tagged ECU04_1630 as bait

  • Co-immunoprecipitation with antibodies specific to ECU04_1630

  • Surface plasmon resonance to measure binding kinetics with potential interactors

  • Far-western blotting to detect direct protein interactions

In vivo methods:

  • Yeast two-hybrid screening, with modifications for membrane protein analysis

  • Proximity labeling approaches such as BioID or APEX

  • Co-localization studies using fluorescently tagged proteins in heterologous expression systems

Computational methods:

  • Prediction of interaction partners based on homology to known protein families

  • Structural modeling to identify potential binding interfaces

  • Analysis of co-expression patterns in transcriptomic data

These approaches should be combined to build a comprehensive interaction network that could provide functional insights for this uncharacterized protein.

How should researchers design experiments to investigate the potential role of ECU04_1630 in pathogenesis?

To investigate the role of ECU04_1630 in E. cuniculi pathogenesis, consider this experimental framework:

  • Expression analysis during infection cycle:

    • Quantify ECU04_1630 expression at different developmental stages

    • Compare expression levels between virulent and attenuated strains

    • Examine regulation under different environmental conditions

  • Localization studies:

    • Use immunofluorescence to determine subcellular localization

    • Examine changes in localization during host cell invasion and parasite development

    • Investigate potential association with parasite-host interface structures

  • Functional analysis:

    • Generate knockout or knockdown models if genetic manipulation systems are available

    • Assess effects on parasite growth, development, and host cell interaction

    • Perform complementation studies to confirm phenotypes

  • Host interaction studies:

    • Investigate host cell responses to recombinant ECU04_1630

    • Examine potential immunomodulatory effects

    • Identify host proteins that interact with ECU04_1630

  • Comparative analysis:

    • Compare sequence and function with homologs in other microsporidian species

    • Analyze conservation across clinical isolates

What analytical approaches should be used to generate high-quality data from ECU04_1630 experiments?

Effective analysis of ECU04_1630 experiments requires rigorous methodology:

Analytical ApproachApplication to ECU04_1630 ResearchConsiderations
Descriptive AnalysisCharacterizing protein propertiesRequires standardized protocols for reproducibility
Comparative AnalysisEvaluating homology with characterized proteinsNeeds appropriate algorithm selection
Structural AnalysisPredicting protein folding and domainsConsider limitations of in silico predictions
Functional AnalysisAssessing protein activity and interactionsRequires controls to validate specificity
Statistical AnalysisQuantifying experimental outcomesMust match analysis method to data distribution

How can researchers validate the specificity of antibodies against ECU04_1630?

Validating antibody specificity for ECU04_1630 requires a multi-faceted approach:

  • Western blot validation:

    • Confirm recognition of recombinant ECU04_1630 at the expected molecular weight

    • Test against lysates from E. cuniculi and non-infected controls

    • Perform peptide competition assays to confirm epitope specificity

  • Immunofluorescence controls:

    • Compare staining patterns between infected and uninfected samples

    • Perform co-localization studies with known markers

    • Test pre-immune serum as negative control

  • Cross-reactivity assessment:

    • Test against related Encephalitozoon species (E. intestinalis, E. hellem)

    • Evaluate potential cross-reactivity with host proteins

    • Use knockout or knockdown samples as gold-standard negative controls if available

  • Epitope mapping:

    • Determine whether antibodies recognize wall epitopes (exospore/endospore) or internal epitopes (cytoplasm/sporoplasm)

    • Use transmission electron microscopy with immunogold labeling for precise localization

These validation steps are essential before using antibodies in experimental or diagnostic applications.

What data analysis pipeline should be implemented for proteomic characterization of ECU04_1630?

A comprehensive proteomic analysis pipeline for ECU04_1630 should include:

  • Sample preparation optimization:

    • Develop efficient extraction protocols for membrane proteins

    • Evaluate different solubilization methods and detergents

    • Optimize digestion protocols for membrane proteins

  • Mass spectrometry approach:

    • Select appropriate ionization techniques and mass analyzers

    • Develop targeted methods for ECU04_1630 detection

    • Consider cross-linking mass spectrometry for structural information

  • Data processing workflow:

    • Implement appropriate search algorithms for protein identification

    • Use statistical methods to assess confidence in identifications

    • Apply quantitative methods for expression analysis

  • Post-translational modification analysis:

    • Search for common modifications (phosphorylation, glycosylation)

    • Validate predictions with targeted experiments

    • Map modifications to protein sequence and structure

  • Integration with other data types:

    • Correlate proteomic findings with transcriptomic data

    • Compare results with structural predictions

    • Relate to functional assays

This systematic approach facilitates comprehensive characterization of this uncharacterized membrane protein and provides a foundation for functional studies.

What emerging technologies show promise for advancing our understanding of ECU04_1630?

Several cutting-edge technologies could accelerate characterization of ECU04_1630:

  • Cryo-electron microscopy:

    • Determine high-resolution structure without crystallization

    • Visualize protein in native membrane environment

    • Study conformational changes under different conditions

  • Single-cell proteomics:

    • Examine expression heterogeneity within parasite populations

    • Correlate protein levels with developmental stages

    • Identify rare cell states or subpopulations

  • CRISPR-based approaches:

    • Develop genetic manipulation systems for microsporidia

    • Create conditional knockdowns to study essential functions

    • Perform high-throughput screens to identify interacting proteins

  • Advanced imaging techniques:

    • Super-resolution microscopy for precise localization

    • Live-cell imaging to track protein dynamics

    • Correlative light and electron microscopy for structural context

  • Artificial intelligence applications:

    • Improve structural prediction accuracy

    • Identify subtle patterns in experimental data

    • Generate testable hypotheses about protein function

These technologies, while challenging to implement, offer significant potential for characterizing this poorly understood protein.

How might research on ECU04_1630 contribute to broader understanding of microsporidian biology?

Investigation of ECU04_1630 could advance several key areas in microsporidian research:

  • Membrane biology and organization:

    • Characterizing this membrane protein could reveal unique aspects of microsporidian membrane structure

    • Findings may identify specialized domains or compartments in these minimalistic eukaryotes

    • Results could illuminate evolutionary adaptations for intracellular parasitism

  • Host-parasite interactions:

    • If ECU04_1630 localizes to the parasite surface or host-parasite interface, it could mediate critical interaction events

    • Understanding its function might reveal novel mechanisms of host manipulation

    • Findings could identify potential therapeutic targets for microsporidiosis

  • Evolutionary insights:

    • Comparative analysis with other microsporidian species might reveal conserved or divergent features

    • Identification of homologs in other organisms could place the protein in evolutionary context

    • Functional characterization could illuminate adaptive mechanisms in these highly reduced parasites

Through careful experimental design and rigorous analysis, research on this uncharacterized protein has potential to significantly advance our understanding of these emerging pathogens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.