Recombinant Encephalitozoon cuniculi Uncharacterized membrane protein ECU05_0140 (ECU05_0140)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for guaranteed fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ECU05_0140; Uncharacterized membrane protein ECU05_0140
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-458
Protein Length
full length protein
Species
Encephalitozoon cuniculi (strain GB-M1) (Microsporidian parasite)
Target Names
ECU05_0140
Target Protein Sequence
MQAISSSTLKGKVYTPIPPSESVFVYISLFLLQIFKNSRLELVLRLLKKHCIRRPIGRTC TPLSFCVPFHRQTSEKKNKRKFGIADLPLLLFQKGDRLSLHNKENLRINLAVSKFLKKYI ISQNYKYPKNPMSIMKSKIAKTLVVVVVAIAIFTLVLLMLWEGPLGTLTEENLTELNGEV PFRFKDSGSNEEGKDVTLSKFFVCLNKVLRSADDSLSSYLCCGETSEEEGESKKGKYVKN AITEARNMMFRVKDSKDVILEILKKGDKNRNELAETVSNAFSAVETSEGSDQESEGADEQ GKIEKLNTALAELYIWIWLKGIPEEDKRTLQFRKTYKENQSVKNLLDGLDEENREVAEST ILVKVGKKEDSMHVIEHILTSIFQANGYMEKGSIKQAYLSAKASVAAAGGSLGKKVSEVS DNEGKGLIDSLFGMIGWRNNSNNNSSVSKKKEEQGVNS
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Encephalitozoon cuniculi and why study its uncharacterized membrane proteins?

Encephalitozoon cuniculi is a microsporidian parasite that causes infections in both immunocompromised humans and various animals. Studying its uncharacterized membrane proteins like ECU05_0140 is crucial for several reasons:

  • These proteins may play vital roles in host-parasite interactions and infection mechanisms

  • Understanding their structure and function could reveal novel therapeutic targets

  • Membrane proteins often serve as essential components for parasite survival and reproduction

  • Characterizing these proteins contributes to our broader understanding of microsporidian biology and evolution

The ECU05_0140 protein specifically warrants investigation as it is a full-length membrane protein (458 amino acids) that may have significant functions in parasite physiology or host interaction .

How should researchers design experiments to characterize the function of ECU05_0140?

When designing experiments to characterize ECU05_0140 function, researchers should apply rigorous experimental design principles:

Step 1: Define clear research questions and hypotheses

  • Formulate specific hypotheses about potential functions (e.g., "ECU05_0140 functions in nutrient transport")

  • Establish null and alternative hypotheses for statistical testing

Step 2: Identify and control variables

  • Independent variables: Experimental conditions being manipulated (e.g., expression levels, mutation sites)

  • Dependent variables: Measurable outcomes (e.g., protein localization, interaction partners)

  • Control variables: Factors that must remain constant (e.g., cell culture conditions, buffer composition)

Step 3: Implement randomization and replication

  • Randomly assign experimental units to treatment groups

  • Perform sufficient biological and technical replicates

  • Establish appropriate positive and negative controls

Step 4: Use multiple complementary approaches

  • Combine biochemical, molecular, and cellular techniques

  • Employ both in vitro and in vivo methods when possible

  • Validate findings using orthogonal experimental approaches

Experimental ApproachAdvantagesLimitationsKey Controls
Localization studiesReveals cellular contextMay not indicate functionMarkers for cellular compartments
Protein-protein interactionIdentifies potential pathwaysFalse positives possibleNon-interacting protein controls
Gene knockout/knockdownDirect functional assessmentMay be lethal or compensatedWild-type comparisons
Structure determinationReveals functional domainsTechnically challengingSimilar protein structures
Heterologous expressionEasier manipulationMay miss native interactionsEmpty vector controls

What controls are essential when working with recombinant ECU05_0140?

When conducting experiments with recombinant ECU05_0140, several controls are essential to ensure reliable and interpretable results:

Expression system controls:

  • Empty vector control: Cells transformed with expression vector lacking ECU05_0140 insert

  • Positive control: Expression of a well-characterized membrane protein of similar size

  • Toxicity control: Assessment of host cell viability following induction

Purification controls:

  • Pre-induction samples to confirm protein expression is induced

  • Western blot with anti-His antibody to verify tag presence and protein integrity

  • Size exclusion chromatography to assess protein aggregation state

Functional assay controls:

  • Denatured protein control to confirm activity requires native conformation

  • Dose-response measurements to establish specific activity parameters

  • Temperature and pH controls to define optimal conditions

Implementing these controls allows researchers to distinguish true experimental effects from artifacts and ensures experimental validity through proper variable control .

What approaches can resolve contradictory data in ECU05_0140 functional studies?

When facing contradictory results in ECU05_0140 functional studies, researchers should:

Step 1: Critically review experimental designs

  • Examine differences in experimental conditions (expression systems, buffer compositions, etc.)

  • Assess the validity of controls used in each study

  • Consider biological vs. technical variability sources

Step 2: Perform reconciliation experiments

  • Design experiments specifically to address the contradiction

  • Systematically test variables that differ between contradictory studies

  • Implement more stringent controls and increased replication

Step 3: Apply multiple methodologies

  • Use orthogonal techniques to measure the same parameter

  • Combine in vitro and in vivo approaches

  • Employ both structural and functional analyses

Step 4: Collaborate and validate independently

  • Engage multiple laboratories to independently test hypotheses

  • Standardize protocols across research groups

  • Share reagents to eliminate preparation differences as a variable

This systematic approach can determine whether contradictions arise from technical artifacts, biological complexity, or context-dependent protein functions .

How can structural analysis contribute to understanding ECU05_0140's function?

Structural analysis provides crucial insights into ECU05_0140's potential functions through several approaches:

Computational structural prediction:

  • Secondary structure prediction identifies potential functional domains

  • Transmembrane topology models reveal membrane orientation

  • Homology modeling can suggest functional similarities to characterized proteins

Experimental structure determination:

  • X-ray crystallography of purified protein (challenging for membrane proteins)

  • Cryo-electron microscopy for membrane protein complexes

  • Nuclear magnetic resonance for flexible regions and dynamics

Structure-function correlation:

  • Site-directed mutagenesis based on structural features

  • Functional assays of engineered protein variants

  • Cross-linking studies to identify interaction interfaces

The amino acid sequence of ECU05_0140 suggests multiple transmembrane domains and potential interaction motifs that could be systematically analyzed through structural studies to guide functional characterization .

What purification strategies are most effective for recombinant ECU05_0140?

Purifying recombinant membrane proteins like ECU05_0140 requires specialized approaches:

Optimal expression conditions:

  • Expression in E. coli systems with membrane protein-specific strains (C41, C43)

  • Lowered induction temperature (16-20°C) to promote proper folding

  • Use of mild detergents during cell lysis

Extraction optimization:

  • Screen multiple detergents (DDM, LDAO, Fos-choline) for efficient solubilization

  • Test detergent-to-protein ratios systematically

  • Consider native lipid co-extraction methods

Purification procedure:

  • Immobilized metal affinity chromatography using the N-terminal 10xHis-tag

  • Size exclusion chromatography to remove aggregates

  • Optional ion exchange chromatography for additional purity

Quality assessment:

  • SDS-PAGE and Western blotting to confirm identity and purity

  • Circular dichroism to verify secondary structure integrity

  • Dynamic light scattering to assess homogeneity

For long-term storage, maintaining the purified ECU05_0140 in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 helps preserve stability, with lyophilized powder offering extended shelf life (12 months) compared to liquid formulations (6 months) .

What bioinformatic approaches can predict functional domains in ECU05_0140?

Researchers can employ multiple bioinformatic strategies to predict functional domains in ECU05_0140:

Sequence-based analysis:

  • BLAST searches against characterized proteins to identify homologous domains

  • Motif scanning using PROSITE, Pfam, and other databases

  • Signal peptide prediction with SignalP

  • Transmembrane domain prediction using TMHMM or Phobius

Evolutionary analysis:

  • Multiple sequence alignment with homologs from related species

  • Conservation analysis to identify functionally important residues

  • Coevolution analysis to predict interacting residues

  • Phylogenetic profiling to suggest functional associations

Structural prediction:

  • Secondary structure prediction using PSIPRED

  • 3D structure modeling with AlphaFold2 or RoseTTAFold

  • Binding site prediction based on structural features

  • Molecular dynamics simulations to assess flexibility and potential conformational changes

These computational approaches generate testable hypotheses about ECU05_0140's function that can guide experimental design and interpretation .

How can researchers ensure reproducibility in ECU05_0140 studies?

Ensuring reproducibility in ECU05_0140 research requires:

Detailed methodology documentation:

  • Complete reporting of all buffer compositions and reagents

  • Precise description of expression constructs including all tags

  • Step-by-step protocols with timing information

  • Clear specification of equipment settings and parameters

Data transparency:

  • Sharing of raw data alongside processed results

  • Documentation of all data processing steps and software versions

  • Inclusion of all replicates, including those with unexpected results

  • Provision of confidence intervals and effect sizes, not just p-values

Independent validation:

  • Verification of key findings using alternative methods

  • Replication across different batches of recombinant protein

  • Testing in multiple cell types or expression systems

  • Collaboration with independent laboratories

Quality control measures:

  • Regular authentication of cell lines and bacterial strains

  • Verification of protein identity by mass spectrometry

  • Batch-to-batch consistency checks

  • Stability testing under experimental conditions

Following these practices ensures that research on ECU05_0140 builds a reliable foundation of knowledge that can be extended by the broader scientific community.

What are the most promising research avenues for understanding ECU05_0140 function?

Based on current knowledge gaps, several research directions offer particular promise:

Comparative genomics approach:

  • Analysis of ECU05_0140 homologs across microsporidian species

  • Correlation of protein sequence variations with parasite host range

  • Investigation of evolutionary conservation patterns

Interactome mapping:

  • Identification of protein interaction partners in the parasite

  • Characterization of interactions with host proteins during infection

  • Discovery of protein complexes containing ECU05_0140

In vivo functional studies:

  • Development of gene editing approaches in Encephalitozoon cuniculi

  • Creation of conditional knockdown systems to assess essentiality

  • Live imaging of protein dynamics during infection processes

Translational applications:

  • Assessment of ECU05_0140 as a potential therapeutic target

  • Investigation of immunogenic properties for diagnostic applications

  • Exploration of structural features for drug design

These research directions should be pursued using rigorous experimental design principles, with careful attention to controls, reproducibility, and methodological validation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.