Recombinant Encephalitozoon cuniculi Uncharacterized membrane protein ECU07_0530 (ECU07_0530)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ECU07_0530; Uncharacterized membrane protein ECU07_0530
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-412
Protein Length
full length protein
Species
Encephalitozoon cuniculi (strain GB-M1) (Microsporidian parasite)
Target Names
ECU07_0530
Target Protein Sequence
MYCLRAAGGRLWKKEPIKFYYKYPFARRGKMRAETSSGSKRTFKTLRTGFLGLVGVIAVY YALLFIFGIKYLNPQYYGSYFYAWRVNFADKLMTHGRYKLIKKNEHPETEDRKRFYRISQ DKEGPYLIRFDRPEHFPRGHEHQFSLNFPAYEDFLKVRERFIVESEGLQENMKLEHSDLM EQMKKEKGGLFFASYSGKSVEEMMRILFPNNNADRNPWFDVSNILIRAVSRIMSQDEKDR EGYLFDGSEVGDDLMKDIREGLDALDRSAGDGDVLLSEKISDADIKNFFINNGRVSGTPQ ETFAYSRLYYLFNFLTAGIEFKSERLAELRGDGESSNEFREARMDYVANVFARIFASIYP NQHKKDVSNIGVLEKVRNYYSPKMTVDPEKEVDDADLELVRESFSRSSRISA
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Encephalitozoon cuniculi and why is ECU07_0530 significant?

Encephalitozoon cuniculi is a microsporidial parasite belonging to a diverse phylum of obligate intracellular parasitic protists that infect various animal groups and have emerged as human pathogens with limited treatment options. E. cuniculi causes significant pathology, particularly in immunocompromised individuals, affecting multiple tissue types and organ systems . The parasite employs a unique infection strategy using its polar tube, which remains coiled within the resting spore but can erupt with sufficient force to penetrate host cell membranes .

The membrane protein ECU07_0530 is significant because it is potentially part of the infectious apparatus of E. cuniculi. It was included in research based on its homology to recently identified Spore Wall Proteins (SWPs) of silkworm-parasitic microsporidium Nosema . Understanding this protein's structure and function may provide critical insights into the infection mechanism and potentially identify targets for therapeutic intervention.

What are the known structural characteristics of ECU07_0530?

ECU07_0530 is classified as an uncharacterized membrane protein in E. cuniculi. While detailed structural information specifically for ECU07_0530 is limited in the available literature, similar uncharacterized membrane proteins in E. cuniculi have been studied . These proteins typically contain hydrophobic domains that facilitate their integration into membranes, potentially including the spore wall or polar tube membranes.

Based on its homology to known spore wall proteins (SWPs) from related microsporidial species like Nosema , ECU07_0530 likely contains structural motifs common to proteins involved in spore wall formation or stability. These may include:

  • Transmembrane domains for membrane anchoring

  • Signal peptides for proper localization

  • Potential glycosylation sites that contribute to protein stability

  • Conserved domains involved in protein-protein interactions

How does E. cuniculi infection manifest in host organisms?

E. cuniculi infection, known as encephalitozoonosis, is a significant microsporidial disease particularly well-documented in pet rabbits (Oryctolagus cuniculus). The infection primarily affects the renal system and central nervous system . In rabbits, vestibular disease is frequently reported as one of the most common clinical manifestations of chronic E. cuniculi infection .

The pathogenesis involves several stages:

  • Initial infection, often through ingestion of spores

  • Germination of spores and injection of sporoplasm into host cells via the polar tube

  • Multiplication within host cells

  • Formation of new spores

  • Host cell rupture and dissemination of infection

Importantly, the histological severity and distribution of lesions associated with E. cuniculi infection do not always correlate directly with the severity of neurologic clinical signs or the neuroanatomic localization of antemortem neurologic disease . This disconnect between pathology and clinical presentation creates challenges for both diagnosis and treatment assessment.

What expression systems are commonly used for recombinant production of E. cuniculi proteins?

For the recombinant production of E. cuniculi proteins like ECU07_0530, several expression systems have been employed by researchers:

  • Bacterial expression systems: Escherichia coli remains the most commonly used system due to its simplicity, rapid growth, and high protein yields. For membrane proteins like ECU07_0530, specialized E. coli strains (e.g., C41(DE3), C43(DE3)) engineered for membrane protein expression may be preferable.

  • Yeast expression systems: Saccharomyces cerevisiae and Pichia pastoris offer eukaryotic processing capabilities while maintaining relatively simple growth requirements. These systems may provide better protein folding and post-translational modifications compared to bacterial systems.

  • Insect cell expression systems: Baculovirus-infected insect cells (Sf9, Sf21, High Five) often provide higher yields of properly folded eukaryotic proteins with post-translational modifications.

  • Mammalian cell expression systems: For studies requiring the most native-like protein structure and modifications, mammalian cells (CHO, HEK293) may be used, though with increased complexity and cost.

The choice of expression system should consider the specific experimental requirements, including the need for post-translational modifications, protein solubility, functional assays, and yield requirements.

How should researchers design experiments to characterize ECU07_0530 function?

When designing experiments to characterize the function of ECU07_0530, researchers should consider a comprehensive approach that addresses multiple aspects of protein function :

  • Establish clear research questions and hypotheses:

    • Is ECU07_0530 involved in spore wall integrity?

    • Does it participate in host cell recognition or adhesion?

    • Is it involved in polar tube function during infection?

  • Consider the variable properties of experimental subjects:

    • Use multiple cell lines to test host-parasite interactions

    • Account for variations in protein expression levels

    • Control for host cell factors that might influence results

  • Carefully define manipulated variables:

    • Create precise mutation constructs to identify functional domains

    • Establish dose-response relationships in interaction studies

    • Design time-course experiments to capture dynamic processes

  • Measurement of outcomes:

    • Use multiple complementary techniques to assess protein function

    • Include appropriate controls for each methodology

    • Quantify results using standardized metrics

  • Account for variability:

    • Perform biological and technical replicates

    • Use statistical analyses appropriate for the experimental design

    • Consider potential sources of experimental error

A well-designed experimental approach might include:

Experimental ApproachKey TechniquesExpected OutcomesLimitations
Localization studiesImmunofluorescence, electron microscopy with immunogold labelingSubcellular localization of ECU07_0530Requires specific antibodies
Protein interaction studiesCo-immunoprecipitation, yeast two-hybrid, proximity labelingIdentification of binding partnersMay identify non-physiological interactions
Gene knockout/knockdownCRISPR-Cas9, RNAi (if applicable)Phenotypic effects of protein absenceTechnical challenges in microsporidian genetic manipulation
Functional assaysHost cell infection assays with wild-type vs. mutant proteinsImpact on infection efficiencyRequires optimization of infection models

What are the best methods for purifying recombinant ECU07_0530?

Purifying membrane proteins like ECU07_0530 presents specific challenges due to their hydrophobic nature. The following methodological approach is recommended:

  • Optimization of expression conditions:

    • Test various expression tags (His, GST, MBP) to improve solubility

    • Optimize induction conditions (temperature, inducer concentration, duration)

    • Consider using fusion partners that enhance solubility

  • Membrane protein extraction:

    • Use mild detergents for initial solubilization (e.g., DDM, LDAO, FC-12)

    • Screen detergent panels to identify optimal solubilization conditions

    • Consider detergent/lipid mixtures for maintaining native-like environment

  • Purification strategy:

    • Implement a multi-step purification process:
      a. Affinity chromatography (based on chosen tag)
      b. Size exclusion chromatography for further purification
      c. Ion exchange chromatography if needed for higher purity

  • Quality assessment:

    • Verify protein identity using mass spectrometry

    • Assess purity by SDS-PAGE and Western blotting

    • Confirm proper folding using circular dichroism or limited proteolysis

For membrane proteins like ECU07_0530, considering alternative approaches such as amphipols or nanodiscs for stabilization after purification may improve protein stability and functionality for downstream analyses.

How can researchers validate antibodies against ECU07_0530?

Antibody validation is critical for ensuring reliable results in protein studies. For ECU07_0530, a comprehensive validation approach should include:

  • Initial validation:

    • Western blot against recombinant protein and native protein from E. cuniculi

    • Testing antibody specificity using knockout/knockdown controls if available

    • Cross-reactivity assessment against other E. cuniculi proteins

  • Application-specific validation:

    • For immunofluorescence: Peptide competition assays and colocalization with known markers

    • For immunoprecipitation: Mass spectrometry confirmation of pulled-down proteins

    • For ELISA: Standard curve with recombinant protein and detection limits determination

  • Reproducibility assessment:

    • Testing multiple antibody lots

    • Evaluating performance across different sample preparations

    • Comparing results from different detection methods

  • Documentation and reporting:

    • Detailed recording of all validation experiments

    • Reporting of antibody catalog numbers, dilutions, and incubation conditions

    • Sharing validation data when publishing results

A robust validation strategy ensures confidence in downstream experimental results and contributes to reproducibility in the field.

How do researchers resolve contradictory findings about ECU07_0530 function?

Resolving contradictions in research findings is crucial for advancing understanding of proteins like ECU07_0530. When faced with apparent contradictions in the literature, researchers should follow this systematic approach :

  • Contextual analysis of contradictory claims:

    • Identify specific methodological differences between studies

    • Examine the experimental systems used (in vitro vs. in vivo, cell types)

    • Consider differences in protein constructs, tags, or expression systems

  • Normalization of terminology and metrics:

    • Ensure that similar terms across studies refer to the same concepts

    • Standardize metrics and measurements for proper comparison

    • Address any acronym or terminology inconsistencies

  • Replication with controlled variables:

    • Design experiments that specifically address the contradictory aspects

    • Control for variables that differed between original studies

    • Implement blinded assessment of outcomes when possible

  • Meta-analysis approach:

    • Systematically evaluate the strength of evidence for competing claims

    • Consider statistical power and sample sizes of original studies

    • Assess risk of bias in published studies

  • Collaborative resolution:

    • Engage with authors of contradictory studies when possible

    • Share data and methodologies openly

    • Consider multi-laboratory replication efforts

When analyzing contradictory findings, researchers should focus on identifying the specific experimental conditions that might explain different outcomes, rather than simply determining which study is "correct."

What computational approaches can predict ECU07_0530 structure and function?

With limited experimental data available for uncharacterized proteins like ECU07_0530, computational approaches offer valuable insights into potential structure and function:

  • Sequence-based analysis:

    • Homology detection using PSI-BLAST, HHpred, and HMMER

    • Motif identification using PROSITE, InterPro, and SMART

    • Disorder prediction using IUPred2A and MobiDB

  • Structural prediction:

    • Template-based modeling using tools like SWISS-MODEL or Phyre2

    • Ab initio modeling using Rosetta or AlphaFold2

    • Molecular dynamics simulations to assess structural stability

  • Functional prediction:

    • Gene ontology term assignment through tools like DeepGOPlus

    • Protein-protein interaction prediction using STRING or HIPPIE

    • Ligand binding site prediction using FTSite or 3DLigandSite

  • Integrative approaches:

    • Combining multiple prediction methods for consensus building

    • Network-based function prediction using gene co-expression data

    • Evolutionary analysis to identify conserved functional residues

These computational predictions can guide experimental design and provide testable hypotheses about protein function, potentially saving significant time and resources in the characterization of uncharacterized proteins like ECU07_0530.

How can researchers determine if ECU07_0530 interacts with host proteins during infection?

Investigating host-parasite protein interactions is crucial for understanding infection mechanisms. For ECU07_0530, several complementary approaches can be employed:

  • Affinity-based methods:

    • Pull-down assays using recombinant ECU07_0530 as bait with host cell lysates

    • Co-immunoprecipitation from infected cells followed by mass spectrometry

    • Protein microarrays to screen for interactions with host protein libraries

  • Proximity-based approaches:

    • BioID or APEX2 proximity labeling in infection models

    • FRET/BRET analyses with fluorescently tagged proteins

    • Cross-linking mass spectrometry (XL-MS) in infected cells

  • Genetic approaches:

    • Yeast two-hybrid screening against host protein libraries

    • Suppressor/enhancer genetic screens in model systems

    • CRISPR screens to identify host factors affecting ECU07_0530 function

  • Structural studies:

    • Crystallization of ECU07_0530 with potential host binding partners

    • Cryo-EM analysis of protein complexes

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

The integration of these approaches provides a comprehensive view of potential host-parasite protein interactions and their functional significance in the infection process.

What are the challenges in developing genetic manipulation systems for studying ECU07_0530 in vivo?

Genetic manipulation of microsporidia like E. cuniculi presents significant challenges due to their obligate intracellular lifestyle and compact genomes. Key challenges include:

  • Technical barriers:

    • Difficulty maintaining microsporidia outside host cells

    • Compact genome with minimal intergenic regions

    • Limited selectable markers for transformant selection

    • Challenges in delivering DNA/RNA into spores

  • Regulatory mechanisms:

    • Limited understanding of promoter elements and gene regulation

    • Uncertainty about RNA processing mechanisms

    • Poor characterization of replication origins and plasmid maintenance

  • Phenotypic assessment:

    • Complex life cycle makes phenotypic screening difficult

    • Inability to easily culture organisms on artificial media

    • Challenges in distinguishing transformation effects from normal variation

Potential strategies to overcome these challenges include:

  • Development of cell-free cultivation systems for microsporidia

  • Adaptation of CRISPR-Cas9 systems for microsporidian genome editing

  • Creation of reporter systems compatible with microsporidian biology

  • Establishing transient expression systems as stepping stones to stable transformation

Progress in this area would significantly advance the ability to functionally characterize proteins like ECU07_0530 in their native context.

How can researchers overcome solubility issues with recombinant ECU07_0530?

Membrane proteins like ECU07_0530 often present solubility challenges during recombinant expression. Here are methodological approaches to address these issues:

  • Construct optimization:

    • Create truncated constructs removing highly hydrophobic regions

    • Design fusion proteins with solubility-enhancing partners (MBP, SUMO, Trx)

    • Optimize codon usage for the expression host

    • Consider removing flexible regions identified by disorder prediction

  • Expression condition optimization:

    • Reduce expression temperature (16-20°C) to slow protein folding

    • Use lower inducer concentrations for more gradual expression

    • Test specialized E. coli strains designed for membrane proteins

    • Supplement with rare tRNAs if codon bias is detected

  • Solubilization strategies:

    • Screen detergent panels (ranging from harsh ionic to mild non-ionic)

    • Test detergent mixtures and lipid addition during extraction

    • Employ amphipathic polymers like amphipols or SMALPs

    • Consider nanodiscs for maintaining a lipid environment

  • Alternative approaches:

    • Cell-free expression systems that allow direct incorporation into liposomes

    • Split protein approaches for separate domain expression and reconstitution

    • Co-expression with known binding partners that may stabilize the protein

Systematic optimization using these strategies can significantly improve the yield of functional recombinant ECU07_0530 for downstream analyses.

What controls are essential when studying ECU07_0530 localization during infection?

When investigating the localization of ECU07_0530 during the E. cuniculi infection process, implementing proper controls is crucial for generating reliable and interpretable results:

  • Antibody specificity controls:

    • Pre-immune serum controls to establish baseline staining

    • Peptide competition assays to confirm binding specificity

    • Secondary antibody-only controls to assess non-specific binding

    • Testing in uninfected cells to identify cross-reactivity with host proteins

  • Co-localization reference controls:

    • Known spore wall markers if ECU07_0530 is suspected to be a SWP

    • Established polar tube proteins for infectious apparatus localization

    • Subcellular markers for various compartments (ER, Golgi, etc.)

    • Time-course controls to track protein localization throughout infection

  • Sample preparation controls:

    • Fixation method comparisons to ensure preservation of structure

    • Permeabilization optimization for accessing different cellular compartments

    • Processing matched infected and uninfected samples in parallel

    • Technical replicates to ensure staining consistency

  • Imaging and quantification controls:

    • Consistent exposure settings across samples for comparison

    • Z-stack acquisition to ensure complete sampling of 3D structures

    • Signal intensity calibration standards

    • Blinded assessment of localization patterns

These controls help distinguish genuine localization patterns from artifacts and provide confidence in the biological significance of the observations.

How can researchers distinguish the effects of ECU07_0530 from other E. cuniculi proteins?

Distinguishing the specific effects of ECU07_0530 from other E. cuniculi proteins requires careful experimental design:

  • Specific perturbation approaches:

    • Targeted antibody inhibition with highly specific antibodies

    • Expression of dominant-negative mutants in infection models

    • Competitive inhibition using recombinant protein fragments

    • RNAi or antisense approaches if applicable in the system

  • Comparative analysis:

    • Parallel studies with related proteins (e.g., other SWPs)

    • Systematic mutation of conserved vs. unique domains

    • Chimeric protein construction to map functional domains

    • Cross-species complementation experiments

  • Temporal and spatial resolution:

    • High-resolution time-course studies to identify primary vs. secondary effects

    • Subcellular compartment-specific analyses

    • Single-cell approaches to account for heterogeneity

    • Correlative light and electron microscopy for ultrastructural context

  • Functional readouts with specificity controls:

    • Multiple independent assays measuring the same functional outcome

    • Dose-response relationships to establish causality

    • Rescue experiments to confirm specificity of observed effects

    • Careful statistical analysis to distinguish specific from non-specific effects

These approaches help establish the specific contribution of ECU07_0530 to observed phenotypes in the context of multiple interacting E. cuniculi proteins.

What academic research resources are available for studying ECU07_0530?

Researchers interested in studying ECU07_0530 can access various academic resources:

  • Genomic and proteomic databases:

    • UniProt for protein sequence and annotation data

    • MicrosporidiaDB for E. cuniculi-specific genomic information

    • PDB for structural information on related proteins

    • EuPathDB for comparative analysis with other pathogens

  • Research materials:

    • Plasmid repositories for relevant expression vectors

    • Antibody resources if ECU07_0530-specific antibodies exist

    • E. cuniculi strains from culture collections

    • Cell line repositories for host-parasite interaction studies

  • Computational resources:

    • Protein prediction servers for structure and function analysis

    • Molecular dynamics simulation platforms

    • Bioinformatics analysis pipelines for omics data

    • High-performance computing resources for intensive analyses

  • Funding opportunities:

    • NIH/NIAID grants focused on opportunistic infections

    • NSF funding for basic biological research

    • Specialized parasitology research foundations

    • Institutional core facility access

  • Educational resources:

    • Protocols and methodologies from published studies

    • Undergraduate research opportunities for supporting projects

    • Training workshops on specialized techniques

    • Online courses on relevant methodologies

Access to these resources can significantly accelerate research progress and foster collaborative opportunities.

How can undergraduate students contribute to ECU07_0530 research?

Undergraduate students can make meaningful contributions to research on ECU07_0530 and similar proteins:

  • Entry-level research tasks:

    • Assist with cell culture maintenance and parasite propagation

    • Perform basic molecular biology techniques (PCR, cloning)

    • Conduct literature reviews and data compilation

    • Support protein expression and purification workflows

  • Developing independent projects:

    • Design and test expression constructs for protein domains

    • Optimize conditions for functional assays

    • Create computational models for structure prediction

    • Analyze experimental data and contribute to publications

  • Finding research mentorship:

    • Connect with faculty members working on microsporidian research

    • Engage with department chairs or directors of undergraduate studies

    • Participate in undergraduate research programs at universities

    • Attend scientific conferences to network with researchers

  • Building research skills:

    • Complete core coursework before undertaking research

    • Develop skills in data analysis and scientific writing

    • Learn specialized techniques relevant to protein research

    • Understand experimental design principles

Undergraduate research experiences provide valuable training while contributing to scientific knowledge and can lead to authorship on publications and presentations at scientific meetings.

What are the future research directions for ECU07_0530?

Future research on ECU07_0530 and related E. cuniculi membrane proteins should focus on several promising directions:

  • Structural characterization:

    • Determination of high-resolution structures using cryo-EM or X-ray crystallography

    • Mapping of functional domains through systematic mutagenesis

    • Dynamic structural changes during different infection stages

  • Functional roles:

    • Defining precise contributions to spore wall integrity or organization

    • Investigating potential roles in host cell recognition or attachment

    • Examining involvement in polar tube function or regulation

  • Host-pathogen interactions:

    • Identifying host protein binding partners

    • Characterizing immune system recognition and evasion mechanisms

    • Understanding species-specific interaction differences

  • Therapeutic applications:

    • Evaluation as potential drug targets or vaccine candidates

    • Development of inhibitors that disrupt essential functions

    • Engineering of diagnostic tools based on protein characteristics

  • Technological advances:

    • Development of genetic manipulation systems for E. cuniculi

    • Implementation of high-throughput screening approaches

    • Application of advanced imaging techniques for in vivo studies

Progress in these areas will contribute to a comprehensive understanding of E. cuniculi infection biology and may lead to novel therapeutic strategies for microsporidiosis.

How can contradictions in research findings advance our understanding of ECU07_0530?

Rather than viewing contradictions in research findings as obstacles, they can be leveraged to advance scientific understanding of proteins like ECU07_0530 :

  • Revealing context-dependency:

    • Contradictory results often highlight the importance of specific experimental conditions

    • Differences may reveal protein functions that are dependent on cell type, environmental factors, or protein partners

    • Understanding contradictions can define the boundaries of protein function

  • Driving methodological improvements:

    • Contradictions stimulate critical evaluation of experimental approaches

    • They often lead to development of more robust, sensitive, or specific methods

    • Methodological advances benefit the broader scientific community

  • Generating new hypotheses:

    • Apparent contradictions can suggest previously unconsidered mechanisms

    • They may point to regulatory factors that modulate protein function

    • Reconciling contradictions often reveals greater complexity in biological systems

  • Promoting collaborative science:

    • Resolving contradictions encourages communication between research groups

    • Multi-laboratory studies with standardized protocols can emerge

    • Open data sharing and transparency in reporting methods become prioritized

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.