Recombinant Encephalitozoon cuniculi Uncharacterized membrane protein ECU08_0540 (ECU08_0540)

Shipped with Ice Packs
In Stock

Description

Biological Context

ECU08_0540 is annotated as an uncharacterized membrane protein, though proteomic studies suggest potential roles in spore wall formation or host cell invasion . Key findings include:

  • Localization: Detected in membrane-associated fractions of E. cuniculi spores, implicating it in structural or functional aspects of the parasite’s life cycle .

  • Comparative Analysis: Shares homology with other microsporidian membrane proteins involved in nutrient transport or host immune evasion, though its exact biochemical function remains undefined .

Research Applications

This recombinant protein is primarily used in:

  • Antigen Production: Serves as a target for antibody generation in serological assays (e.g., ELISA, immunofluorescence) .

  • Structural Studies: Facilitates investigations into membrane protein architecture and interactions via X-ray crystallography or cryo-EM .

  • Diagnostic Development: Critical for detecting E. cuniculi infections in rabbits, which present with neurological, urinary, or ocular symptoms .

Clinical Relevance

E. cuniculi infections in rabbits manifest as encephalitozoonosis, characterized by:

  • Neurological Signs: Head tilt, ataxia, seizures .

  • Urinary Dysfunction: Sludgy urine, incontinence .

  • Ocular Lesions: Phacoclastic uveitis .

ECU08_0540 is not directly linked to clinical symptoms but is utilized to study immune responses. Seropositive rabbits show elevated globulin and altered albumin levels, suggesting chronic antigenic stimulation .

Limitations and Future Directions

  • Functional Gaps: The protein’s role in E. cuniculi pathogenesis remains speculative .

  • Diagnostic Challenges: Cross-reactivity with other microsporidian proteins necessitates validation in multi-antigen panels .

  • Therapeutic Potential: Further studies could explore ECU08_0540 as a vaccine candidate or drug target .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributor.
Note: Our proteins are shipped standard with blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ECU08_0540; Uncharacterized membrane protein ECU08_0540
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Encephalitozoon cuniculi (strain GB-M1) (Microsporidian parasite)
Target Names
ECU08_0540
Target Protein Sequence
MSKMDKLAKFEKFDLFFAAIACICGILKVMEMGKEGYPTLGTVSKNGMAVLAVLVALGFL LKYADQMCRRITSHSFSEKGGFLNPCVILSVIEFFMMLICIKAMLFYPAEIPGVDDSSQM EPPISSKFGLFGAIFMPYIFAECIRLLLANKNSRRDRVILGILVLGCLAMAGLAYLEYKG KGNFISAGILGVGLSMLLSRLALVDEDEEDTLLDDSAEGGNVWMYLAMFASFTLVLILLA RSHRILFDNLSFLDSLKSFTFLGRKVSQMASEDPPKDPLPRQEGGGGDTIA
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Encephalitozoon cuniculi and why is it significant in research?

Encephalitozoon cuniculi is a eukaryotic, unicellular, spore-forming, obligate intracellular microorganism belonging to the phylum Microsporidia. Domestic rabbits represent its primary natural host, though it can also infect humans, classifying it as a zoonotic pathogen . The significance of E. cuniculi in research stems from its status as a model organism for microsporidian infections and its unique cellular structures and mechanisms. E. cuniculi possesses specialized invasion organelles such as the polar tube, which are essential for host cell penetration and infection establishment . The organism's minimalist genome and intracellular lifestyle make it valuable for studying evolutionary adaptation and host-pathogen interactions, particularly in immunocompromised hosts where infections can become severe .

What is currently known about the membrane protein ECU08_0540?

ECU08_0540 is classified as an uncharacterized membrane protein encoded in the Encephalitozoon cuniculi genome. Unlike some other E. cuniculi proteins that have been extensively studied, such as the polar tube proteins (PTP2, PTP3) or the spore wall and anchoring disk complex protein EnP1, ECU08_0540 has limited published functional data . The protein is predicted to have transmembrane domains based on its classification as a membrane protein, suggesting potential roles in cell surface interactions, transport, or signaling. Current research efforts aim to express and characterize this protein to understand its structural properties and functional significance in E. cuniculi biology and pathogenesis.

How is ECU08_0540 positioned within the E. cuniculi proteome?

Within the E. cuniculi proteome, ECU08_0540 is one of several membrane proteins that likely contribute to the organism's cellular architecture and function. Unlike the well-characterized proteins identified through mass spectrometry in infected rabbit models (such as heat shock related 70kDa protein, translation elongation factor 1 alpha, zinc finger protein, polysaccharide deacetylase domain-containing protein, polar tube proteins, and spore wall proteins) , ECU08_0540 remains functionally undefined. Its location on chromosome 8 of the E. cuniculi genome distinguishes it from other major antigenic proteins that have been mapped to chromosomes I, III, IV, VI, and XI . Understanding its position within the proteome requires comparative analysis with other membrane proteins and determination of its expression patterns during different stages of the parasite life cycle.

What expression systems are optimal for producing recombinant ECU08_0540?

For producing recombinant ECU08_0540, researchers should consider several expression systems with each offering distinct advantages:

The optimal protocol typically involves:

  • Codon optimization for the chosen expression system

  • Inclusion of purification tags (His-tag as seen in commercial preparations )

  • Temperature optimization (typically lower temperatures of 16-20°C for membrane proteins)

  • Use of detergents for extraction (e.g., n-dodecyl-β-D-maltoside, CHAPS, or Triton X-100)

What purification strategies are most effective for ECU08_0540?

Purification of recombinant ECU08_0540 requires specific protocols designed for membrane proteins:

Recommended Purification Protocol:

  • Membrane Fraction Isolation:

    • Cell lysis via sonication or French press in buffer containing protease inhibitors

    • Differential centrifugation (10,000 × g followed by 100,000 × g) to isolate membrane fractions

  • Solubilization:

    • Treatment with carefully selected detergents (initial screening recommended)

    • Typical effective detergents include n-dodecyl-β-D-maltoside (DDM) at 1-2% or CHAPS at 8-10 mM

  • Affinity Chromatography:

    • Immobilized metal affinity chromatography (IMAC) using His-tag affinity

    • Washing with decreasing detergent concentrations (critical for reducing detergent in final preparation)

  • Secondary Purification:

    • Size exclusion chromatography to separate protein-detergent complexes from free detergent micelles

    • Ion exchange chromatography for further purification if needed

  • Quality Assessment:

    • SDS-PAGE analysis for purity

    • Western blotting using anti-His antibodies

    • Circular dichroism to verify secondary structure integrity

For storage, purified ECU08_0540 should be maintained at -20°C/-80°C as indicated for commercial preparations , with glycerol addition (typically 10%) to prevent freeze-thaw damage.

How can researchers verify the structural integrity of purified ECU08_0540?

Verification of structural integrity for purified ECU08_0540 requires multiple complementary approaches:

  • Circular Dichroism (CD) Spectroscopy:

    • Far-UV CD (190-260 nm) to assess secondary structure composition

    • Near-UV CD (250-350 nm) to evaluate tertiary structure elements

  • Thermal Stability Assessment:

    • Differential scanning calorimetry (DSC) to determine melting temperature

    • Thermal shift assays using fluorescent dyes (e.g., SYPRO Orange)

  • Size and Homogeneity Analysis:

    • Dynamic light scattering (DLS) to confirm monodispersity

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to determine absolute molecular weight and oligomeric state

  • Microscopy Techniques:

    • Negative stain electron microscopy to visualize protein-detergent complexes

    • Atomic force microscopy for surface topology

  • Functional Assays:

    • Lipid binding assays if membrane interaction domains are predicted

    • ATPase activity measurements if relevant functional domains are identified

These methodologies collectively provide comprehensive structural information about the recombinant protein, ensuring that in vitro studies are conducted with properly folded ECU08_0540.

How might ECU08_0540 be involved in E. cuniculi infection processes?

The potential roles of ECU08_0540 in E. cuniculi infection can be investigated through multiple experimental approaches:

  • Infection Stage Expression Analysis:

    • Quantitative PCR and Western blotting at different infection timepoints

    • Immunofluorescence microscopy to localize the protein during host cell invasion, intracellular development, and spore formation

  • Host-Pathogen Interaction Studies:

    • Pull-down assays using recombinant ECU08_0540 to identify host binding partners

    • Yeast two-hybrid screening with host protein libraries

    • Surface plasmon resonance to quantify binding affinities

Based on knowledge of other E. cuniculi membrane proteins, ECU08_0540 might function in:

  • Host cell recognition and attachment

  • Nutrient acquisition across the parasite membrane

  • Evasion of host immune responses

  • Maintenance of the parasitophorous vacuole

  • Spore formation and maturation processes

Understanding these functions requires comparative analysis with other E. cuniculi proteins involved in infection, such as the spore wall and anchoring disk complex protein EnP1, which plays crucial roles in cell adhesion and spore formation .

What immunological significance might ECU08_0540 have in E. cuniculi infections?

The immunological significance of ECU08_0540 can be assessed through several research approaches:

  • Serological Profiling:

    • Western blot analysis using sera from infected rabbits to determine if ECU08_0540 elicits humoral responses similar to the seven identified immunogenic proteins (heat shock related 70kDa protein, translation elongation factor 1 alpha, zinc finger protein, polysaccharide deacetylase domain-containing protein, polar tube proteins, and EnP1)

  • T-Cell Response Analysis:

    • ELISpot assays to measure T-cell activation against ECU08_0540 epitopes

    • Cytokine profiling following stimulation with recombinant protein

  • Vaccination Studies:

    • Evaluation of protective immunity using recombinant ECU08_0540 as a candidate vaccine

    • Challenge studies in animal models to assess protection levels

The immunological research into ECU08_0540 should consider:

  • IgG vs. IgM responses (noting that certain E. cuniculi proteins show distinct antibody class responses during active infection)

  • Differences between subclinical and clinical infections

  • Comparison between neurological and renal manifestations of disease

What experimental approaches can identify potential functions of ECU08_0540?

Identifying functions of uncharacterized proteins like ECU08_0540 requires integrative experimental strategies:

  • Computational Prediction:

    • Sequence-based homology modeling

    • Identification of conserved domains and motifs

    • Prediction of post-translational modifications

    • Protein-protein interaction network analysis

  • Gene Editing Approaches:

    • CRISPR/Cas9-mediated gene knockout (if protocols are established for E. cuniculi)

    • RNA interference to reduce expression

    • Overexpression studies to observe gain-of-function effects

  • Functional Assays:

    • Lipid binding assays to assess membrane interactions

    • Ion channel activity measurements if transmembrane domains suggest transporter function

    • Enzyme activity assays based on predicted functional domains

  • Localization Studies:

    • Generation of fluorescently tagged ECU08_0540 to track during infection

    • Immunogold electron microscopy for precise subcellular localization

    • Fractionation studies to determine membrane association characteristics

These approaches provide complementary data that, when integrated, can elucidate the functional role of ECU08_0540 in E. cuniculi biology.

How does ECU08_0540 compare to characterized membrane proteins in other microsporidian species?

Comparative analysis of ECU08_0540 with membrane proteins from related organisms provides evolutionary and functional context:

SpeciesRelated Membrane ProteinKnown FunctionSequence Similarity to ECU08_0540Research Methods Used
E. intestinalisEIN_080540 (putative)UncharacterizedRequires bioinformatic analysisGenomic comparison
E. hellemEHE_080540 (putative)UncharacterizedRequires bioinformatic analysisGenomic comparison
Nosema ceranaeSimilar membrane proteinsCell surface interactionsLow-moderate (predicted)Structural prediction, localization studies
Nosema bombycisMembrane proteinsHost specificity determinantsLow (predicted)Functional assays, localization

Research approach should include:

  • Multiple sequence alignment of microsporidian membrane proteins

  • Phylogenetic analysis to establish evolutionary relationships

  • Structural modeling to identify conserved domains

  • Expression pattern comparison across species during host infection

This comparative analysis can reveal conserved functional domains that might indicate essential roles in microsporidian biology and identify species-specific adaptations that could explain host range differences.

What is the theoretical relationship between ECU08_0540 and host immune responses?

Based on knowledge of E. cuniculi immunology and membrane protein function, several hypotheses about ECU08_0540's relationship with host immunity can be proposed:

  • Potential as Immune Target:

    • If surface-exposed, ECU08_0540 might elicit antibody responses similar to other E. cuniculi antigens identified in Western blot bands at 135, 75, 50, 40, 30, 28, 25, and 19-20 kDa

    • The protein could be targeted by cell-mediated immunity, which plays the largest role in host protection against E. cuniculi

  • Immune Evasion Mechanisms:

    • As a membrane protein, ECU08_0540 might participate in antigenic variation

    • It could mediate protection from complement-mediated lysis

    • The protein might facilitate intracellular survival by modifying host cell responses

  • Diagnostic Potential:

    • If immunogenic, ECU08_0540 could serve as a diagnostic marker, complementing current serological tests

    • Specific antibody responses against ECU08_0540 might correlate with disease progression or clinical presentation

To investigate these hypotheses, researchers should consider experimental approaches including:

  • Proteomic analysis of host cells during infection to identify changes in immune signaling

  • In vitro neutralization assays using anti-ECU08_0540 antibodies

  • Mass spectrometry-based identification of host proteins interacting with ECU08_0540, similar to methods used in identifying other E. cuniculi proteins

What are common technical challenges when working with recombinant ECU08_0540?

Researchers working with recombinant ECU08_0540 should anticipate several technical challenges specific to membrane proteins:

  • Protein Expression Issues:

    • Low expression yields common with membrane proteins

    • Potential toxicity to expression hosts

    • Inclusion body formation requiring refolding protocols

    • Incomplete post-translational modifications

  • Purification Challenges:

    • Detergent selection critical for maintaining structure and function

    • Potential for protein aggregation during concentration

    • Difficulty separating protein from detergent micelles

    • Limited stability after purification

  • Functional Assay Development:

    • Designing appropriate assays for an uncharacterized protein

    • Reconstructing membrane environments for functional studies

    • Identifying relevant binding partners for interaction studies

  • Storage and Stability:

    • Limited shelf-life even at -20°C/-80°C

    • Potential activity loss after freeze-thaw cycles

    • Detergent precipitation during storage

Solutions include:

  • Screening multiple expression systems concurrently

  • Using fusion partners that enhance solubility and expression

  • Developing nanodiscs or liposome reconstitution protocols

  • Adding stabilizing agents like glycerol during storage

  • Aliquoting preparations to avoid repeated freeze-thaw cycles

How can ECU08_0540 be used to develop diagnostic tools for E. cuniculi infections?

Development of ECU08_0540-based diagnostic tools for E. cuniculi infections would follow this methodological approach:

  • Immunogenicity Assessment:

    • Screening sera from confirmed E. cuniculi-infected rabbits for anti-ECU08_0540 antibodies

    • Determining sensitivity and specificity compared to established antigenic proteins

    • Evaluating correlation between antibody titers and disease progression

  • Assay Development Pipeline:

    • ELISA design using purified recombinant ECU08_0540

    • Lateral flow immunoassay development for point-of-care testing

    • Multiplex assay incorporation alongside other E. cuniculi antigens

  • Clinical Validation:

    • Testing against diverse sample panels including:

      • Confirmed E. cuniculi infections (neurological and renal presentations)

      • Subclinical carriers

      • Uninfected controls

      • Cross-reactivity controls (other microsporidian infections)

  • Performance Optimization:

    • Sensitivity enhancement through signal amplification methods

    • Specificity refinement through epitope mapping and selection

    • Stability testing under various storage conditions

The diagnostic potential would be evaluated against current serological screening methods that detect antibodies against E. cuniculi antigens, with particular attention to whether ECU08_0540 detection could differentiate between active infection and past exposure, a current limitation of available tests .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.